(data stored in ACNUC7421 zone)

EMBL: FM180568.FTSQ

FM180568.FTSQ        Location/Qualifiers
FT   CDS_pept        109272..110102
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="E2348C_0098"
FT                   /product="membrane anchored protein FtsQ involved in growth
FT                   of wall at septum"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07646"
FT                   /db_xref="GOA:B7UIE3"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIE3"
FT                   /protein_id="CAS07646.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
     atgtcgcagg ctgctctgaa cacgcgaaac agcgaagaag aggtttcttc tcgccgcaat        60
     aatggaacgc gtctggcggg gatccttttc ctgctgaccg ttttaacgac agtgttggtg       120
     agcggctggg tcgtgttggg ctggatggaa gatgcgcaac gcctgccgct ctcaaagctg       180
     gtgttgaccg gtgaacgcca ttacacgcgt aatgacgata tccggcagtc gatcctggca       240
     ttgggtgagc caggtacctt tatgacccag gatgtcaaca tcatccagac gcaaatagaa       300
     caacgcctgc cgtggattaa gcaggtgagc gtcagaaagc agtggcctga tgaattgaag       360
     attcatctgg ttgaatatgt gccgattgcg cggtggaatg atcaacatat ggtagacgcg       420
     gaaggaaaca ccttcagcgt gccgccagat cgcaccagca agcaggtgct tccaatgctg       480
     tatggcccgg aaggcagcgc caatgaagtg ttgcagggct atcgcgaaat ggggcagatg       540
     ctggcaaagg acagatttac tctgaaggaa gcggcgatga ccgcgcgacg ttcctggcag       600
     ttgacgctga ataacgatat taagctcaat cttggtcggg gcgatacgat gaaacgtttg       660
     gctcgctttg tagaacttta tccggtttta cagcagcagg cgcaaaccga tggcaaacgg       720
     attagctacg ttgatttgcg ttatgactct ggagcggcag taggctgggc gcccttgccg       780
     ccagaggaat ctactcagca acaaaatcag gcacaggcag aacaacaatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page