(data stored in ACNUC7421 zone)

EMBL: FM180568.FTSW

FM180568.FTSW        Location/Qualifiers
FT   CDS_pept        104520..105764
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="E2348C_0094"
FT                   /product="integral membrane protein FtsW involved in
FT                   stabilizing FstZ ring during cell division"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07642"
FT                   /db_xref="GOA:B7UID9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B7UID9"
FT                   /protein_id="CAS07642.1"
FT                   /translation="MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTNSLIMYD
FT                   RTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPM
FT                   EFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANY
FT                   LVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFVRGSR"
     atgcgtttat ctctccctcg cctgaaaatg ccgcgcctgc caggattcag tattctggtc        60
     tggatctcca cggcgctaaa gggctgggtg atgggctcgc gggaaaaaga taccaacagc       120
     ctgatcatgt acgatcgcac cttactgtgg ctgaccttcg gcctcgcggc gattggcttt       180
     atcatggtga cctcggcgtc aatgcccata gggcaacgct taaccaacga tccgttcttc       240
     ttcgcgaagc gtgatggcgt ctatctgatc ctggcattca ttctggcgat cattacgctg       300
     cgtctaccga tggagttctg gcaacgctac agtgccacga tgctgctcgg atctatcatc       360
     ctgctgatga tcgttctggt agtgggtagc tcggttaaag gggcatcgcg ttggatcgat       420
     ctcggtttgc tgcgtattca gcctgcggag ctgacaaaac tgtcgctgtt ttgctatatc       480
     gccaactatc tggtgcgtaa aggcgacgaa gtacgtaata acctgcgcgg cttcctgaaa       540
     ccgatgggcg taattctggt gttggcagtg ttactgctgg cacagccaga ccttggtacg       600
     gtggtggtgt tgtttgtgac tacgctggcg atgttgttcc tggcgggagc gaaattgtgg       660
     cagttcattg ccattatcgg tatgggcatt tcagcggttg tgttgctgat cctcgccgaa       720
     ccgtaccgta tccgccgtgt taccgcattc tggaacccgt gggaagatcc ctttggcagc       780
     ggctatcagt taacgcaatc gttgatggcg tttggtcgcg gtgaactgtg gggacaaggt       840
     ttaggtaact cggtacaaaa actggagtat ctgccggaag cgcacactga ctttattttc       900
     gccattatcg gcgaagaact ggggtatgtc ggtgtggtgc tggcactttt aatggtattc       960
     ttcgtcgctt ttcgcgcgat gtcgattggc cgcaaagcat tagaaattga ccaccgtttt      1020
     tccggttttc tcgcctgttc tattggtatc tggtttagtt tccaggcgct ggttaacgta      1080
     ggcgcggcgg cggggatgtt accgaccaaa ggtctgacat tgccgctgat cagttacggt      1140
     ggttcgagct tactgattat gtcgacagcc atcatgatgc ttttgcgtat tgattatgaa      1200
     acgcgtctgg agaaagcgca ggcgtttgta cgaggttcac gatga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page