(data stored in ACNUC7421 zone)

EMBL: FM180568.FTSZ

FM180568.FTSZ        Location/Qualifiers
FT   CDS_pept        111422..112573
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="E2348C_0100"
FT                   /product="GTP-binding tubulin-like cell division protein
FT                   FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07648"
FT                   /db_xref="GOA:B7UIE5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIE5"
FT                   /protein_id="CAS07648.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD"
     atgtttgaac caatggaact taccaatgac gcggtgatta aagtcatcgg cgtcggcggc        60
     ggcggcggta atgctgttga acacatggtg cgtgagcgca ttgaaggtgt tgaattcttc       120
     gcggtaaata ccgatgcaca agcgctgcgt aaaacagcgg ttggacagac gattcaaatc       180
     ggtagcggta tcaccaaagg actgggcgct ggcgctaatc cagaagttgg ccgcaatgcg       240
     gctgatgagg atcgcgatgc actgcgtgcg gcgctggaag gtgcagacat ggtctttatt       300
     gctgcgggta tgggtggtgg taccggtaca ggtgcagcac cagtcgtcgc tgaagtggca       360
     aaagatttgg gtatcctgac cgttgctgtc gtcactaagc ctttcaactt tgaaggcaag       420
     aagcgtatgg cattcgcgga gcaggggatc actgaactgt ccaagcatgt ggactctctg       480
     atcactatcc cgaacgacaa actgctgaaa gttctgggcc gtggtatctc cctgctggat       540
     gcgtttggcg cagcgaacga tgtactgaaa ggcgctgtgc aaggtatcgc cgaactgatt       600
     actcgtccgg gtttgatgaa cgtggacttt gcagacgtac gcaccgtaat gtctgaaatg       660
     ggctacgcaa tgatgggttc tggtgtggcg agcggtgaag atcgtgcgga agaagctgct       720
     gaaatggcta tctcttctcc gctgctggaa gatatcgacc tgtctggcgc acgcggcgtg       780
     ctggttaaca tcacagcggg cttcgacctg cgtctggatg agttcgaaac ggtaggtaac       840
     accatccgtg catttgcttc cgacaacgcg actgtggtta tcggtacttc tcttgacccg       900
     gatatgaatg acgagctgcg cgtaaccgtt gttgcgacag gtatcggcat ggacaaacgt       960
     cctgaaatca ctctggtgac caataagcag gttcagcagc cagtgatgga tcgctaccag      1020
     cagcatggga tggctccgct gacccaggag cagaagccgg ttgctaaagt cgtgaatgac      1080
     aatgcgccgc aaactgcgaa agagccggat tatctggata tcccagcatt cctgcgtaag      1140
     caagctgatt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page