(data stored in ACNUC7421 zone)

EMBL: FM180568.GLNK

FM180568.GLNK        Location/Qualifiers
FT   CDS_pept        431515..431853
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="E2348C_0385"
FT                   /product="nitrogen assimilation regulatory protein for
FT                   GlnL, GlnE, and AmtB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07933"
FT                   /db_xref="GOA:B7UJS3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJS3"
FT                   /protein_id="CAS07933.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
     atgaagctgg tgaccgtgat aatcaaacca ttcaagctgg aagacgttcg tgaagcgtta        60
     tcttccattg gtattcaggg cctgaccgtc accgaagtga aaggtttcgg gcgtcagaaa       120
     gggcatgccg agctgtaccg gggggcggaa tacagcgtca acttcctgcc aaaagtaaaa       180
     attgatgtgg cgattgctga tgaccaactc gatgaagtga tcgatatcgt cagcaaagcg       240
     gcttacaccg gaaaaattgg cgacggcaaa atcttcgtcg ctgaattgca acgcgtcatt       300
     cgtattcgta ccggcgaagc cgatgaagcg gcgctgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page