(data stored in ACNUC7421 zone)

EMBL: FM180568.GLTI

FM180568.GLTI        Location/Qualifiers
FT   CDS_pept        complement(607694..608602)
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="E2348C_0548"
FT                   /product="glutamate and aspartate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08096"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKT8"
FT                   /protein_id="CAS08096.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNAERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   EIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
     atgcaattac gtaaacctgc cacagcaatc ctggccctgg cgctttccgc aggactggca        60
     caggcagatg acgccgcccc ggcagcaggc agcacgctgg acaaaatcgc caaaaacggc       120
     gtgattgtcg tcggtcaccg tgaatcttca gtacctttct cttattacga caatcagcaa       180
     aaagtggtgg gctactcgca ggattactcc aacgccattg ttgaagcagt gaaaaagaaa       240
     ctcaacaaac cagacttaca ggtgaaattg attccgatca cctcacaaaa ccgtattcca       300
     ctgctgcaaa acggcacttt cgattttgaa tgcggttcta ccaccaacaa tgccgaacgc       360
     caaaaacagg cggctttctc tgacactatt ttcgtggtcg gtacgcgcct gctgaccaaa       420
     aagggcggcg atatcaaaga ttttgccgac ctgaaaggca aagccgtagt cgtcacttcc       480
     ggcaccacct ctgaagtttt gctcaacaaa ctgaatgaag agcaaaaaat gaatatgcgc       540
     atcatcagcg ccaaagatca cggtgactct ttccgtaccc tggaaagcgg tcgtgccgtt       600
     gcctttatga tggatgatgc tctgctggcc ggtgaacgtg cgaaagcgaa gaaaccagac       660
     aactgggaaa tcgtcggcaa gccgcagtct caggaagcct atggttgcat gttgcgtaaa       720
     gacgatccgc agttcaaaaa gctgatggat gataccatcg ctcaggtgca gacctccggt       780
     gaagcggaaa aatggtttga taagtggttc aaaaatccaa ttccgccgaa aaacctgaac       840
     atgaatttcg aactgtcaga cgaaatgaaa gcactgttca aagaaccgaa tgacaaggca       900
     ctgaactaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page