(data stored in ACNUC7421 zone)

EMBL: FM180568.GLTL

FM180568.GLTL        Location/Qualifiers
FT   CDS_pept        complement(605385..606110)
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="E2348C_0545"
FT                   /product="glutamate and aspartate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08093"
FT                   /db_xref="GOA:B7UKT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKT5"
FT                   /protein_id="CAS08093.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRNKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
     atgattaccc tgaaaaatgt ttcaaaatgg tatggtcact ttcaggtgct gaccgactgc        60
     tcaaccgaag tgaaaaaagg cgaagttgtg gtggtttgcg gtccgtctgg ttccggcaaa       120
     tcaacgctga ttaaaaccgt caacgggctc gaaccggtgc agcaaggtga aatcaccgtc       180
     gatggcatcg tggttaacga caagaaaacc gatctggcga aactgcgttc ccgcgtcggg       240
     atggtgtttc agcatttcga gctgttcccc catctgtcga ttatcgaaaa cctgaccctg       300
     gcgcaggtga aagtgcttaa acgcaataaa gcgccggctc gtgaaaaagc attgaaattg       360
     ctggagcgcg tcgggctttc cgcacatgcc aataagtttc cggcgcagct ttccggcggc       420
     cagcagcagc gtgtggcgat cgctcgcgca ttgtgcatgg atcctattgc catgctgttc       480
     gacgaaccaa cgtcggcgct ggatccggag atgatcaacg aagtgctgga cgtgatggtc       540
     gaactggcga acgaaggaat gacgatgatg gtggtgaccc acgaaatggg ctttgcccgt       600
     aaagtggcga atcgggtgat ctttatggac gagggtaaaa ttgtcgaaga ctcgccgaaa       660
     gacgctttct tcgatgatcc gaaatcggac cgcgcaaaag acttcctcgc aaaaatcctg       720
     cattaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page