(data stored in ACNUC7421 zone)

EMBL: FM180568.GLXK

FM180568.GLXK        Location/Qualifiers
FT   CDS_pept        499851..500996
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="E2348C_0447"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07995"
FT                   /db_xref="GOA:B7UKJ1"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ1"
FT                   /protein_id="CAS07995.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDAHYICLPIADGG
FT                   EGTVEAMVAATDGNIVKLEVCGPMGETVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQPLAA
FT                   NGGNLARVASIEMNECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQLTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     atgaagattg tcattgcgcc agactctttt aaagagagct taagtgcaga aaaatgttgt        60
     caggcaatta aagccgggtt ttcgaccctc tttcccgatg cgcactatat ctgtttgccg       120
     atagcggatg gcggcgaagg gacggtggag gcgatggttg ccgcgacgga cggtaacatc       180
     gtgaagcttg aagtctgtgg accgatgggc gaaacagtga atgcttttta tggccttacc       240
     ggcgacggga aaacggcagt gattgagatg gcggcagcaa gtggcctgat gctggtcgcg       300
     cctgaaaagc gtaatccgtt gctggcctcc agttttggta cgggggagtt aattcgccat       360
     gcgctggata acggcattcg ccatattatt ctcggcattg gcggcagtgc gacggtcgac       420
     ggcggtatgg gcatggcgca ggcgctcggt gtgcgtttcc ttgatgccga cggtcagccg       480
     ctggcggcta acggcggcaa tttagcgcgc gtggcaagta ttgagatgaa tgaatgcgat       540
     ccgcgtctgg cgaactgtca tattgaagtc gcatgtgatg ttgataaccc gctggtaggg       600
     gcacgcggcg cggcggcggt gtttggcccg caaaaagggg caacgccgga gatggtcgaa       660
     gagctggaac aggggctgca aaattacgcc cgtgttttac aacagctaac tgaaatcaac       720
     gtctgccaga tggcgggtgg tggcgcggcg ggcggtatgg gcattgcggc ggcggtattc       780
     ctcaatgcgg atattaaacc gggtattgag attgtgttga atgcggtcaa tcttgcgcag       840
     gcagtgcagg gtgcagcact ggtgatcacc ggggaagggc gcatcgactc gcaaacggca       900
     ggcggtaaag cgccgctggg tgtggcatcg gtggcgaagc agtttaatgt cccggtgatt       960
     gggattgctg gcgtattggg tgatggcgtg gaagtggtgc accagtacgg cattgacgcg      1020
     gtattcagca ttttgcctcg tctggcacct ttagccgaag tgctcgccag cggtgaaacc      1080
     aatctcttca acagcgcgcg taatattgcc tgcgccatta aaataggtca gggaattaaa      1140
     aactga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page