(data stored in ACNUC7421 zone)

EMBL: FM180568.HOFB

FM180568.HOFB        Location/Qualifiers
FT   CDS_pept        complement(121712..123097)
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="E2348C_0110"
FT                   /product="conserved predicted protein HofB with nucleoside
FT                   triphosphate hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07658"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIF5"
FT                   /protein_id="CAS07658.1"
FT                   /translation="MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLACRGGEKVVLRLLQQVNQALDVNTLGMQPSQLVDFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTLNTANINICSVEDPVEIPIAGLNQTQIHSRVGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPDNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
     atgaatattc cacagctcac tgccctgtgt ctgcgttatc agggagtctt gctggatgcc        60
     agcgaagagg tggttcatgt tgcggtagtc gatgcacctt cgcatgagct actggacgca       120
     ttgcatttcg ctaccaccaa acgtattgag atcacctgct ggacgcgcca acaaatggaa       180
     ggtcacgcca gtcgcacaca acagacattg cccgtagctg ttcaggagaa gcatcagccc       240
     aaagcagagt tgctgactcg aacgttacaa tctgcgctgg aacaacgcgc gtctgatatt       300
     catatcgaac cagcggacaa tgcctaccgc atccgcttgc gtatcgacgg cgtattgcat       360
     cctttaccgg acgtttcacc ggatgccgga gtcgcattaa ccgccagatt aaaagtgctg       420
     ggaaacctgg atattgcgga acatcgcctg ccgcaggacg ggcaattcac tgtcgaactg       480
     gcaggaaacg ccgtctcatt tcgtattgcg accttagcat gtcggggtgg tgaaaaggtg       540
     gtattaaggt tgttacagca ggtgaaccag gcactggatg ttaacacgct tggaatgcag       600
     ccgtcacaac tggtggactt tgctcatgcc ttgcaacaac cacagggact ggtgctggta       660
     actggcccta caggcagcgg caaaacggtc acgctttata gtgccctgca aacgctgaat       720
     accgctaaca ttaatatttg tagcgtcgaa gatccggttg agatccccat agccggatta       780
     aaccagacgc aaatccattc gcgtgtcgga ctcacctttc agggcgtttt gcgtgcgtta       840
     ttgcgccagg atcctgacgt catcatgatc ggagagatcc gcgatggcga aacggcagaa       900
     attgccatta aagccgcgca aaccggtcac ctggtgttgt ctaccctaca cactaattcc       960
     acctgcgaaa cgctggtacg tttacagcaa atgggagtcg cccgctggat gctatcatcg      1020
     gcgcttacgc tggtaatagc ccagcgtctg gtacgcaaac tttgcccgca ttgtcgccgg      1080
     cagcaagggg agcccatcca tattccagac aatgtatggc catcgccgct gccccactgg      1140
     caggcacccg gttgtgtaca ttgctaccac ggtttttatg gtcgcacggc cttatttgaa      1200
     gttctgccca taacaccggt catacgtcag cttatttccg ctaataccga cgttgaatcg      1260
     ctggaaacgc acgcccgaca ggcgggtatg cgaacgcttt ttgaaaacgg ctgcctggcc      1320
     gtggagcaag gcttaaccac ctttgaagag ttaatccgcg tattggggat gccgcatggc      1380
     gagtaa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page