(data stored in ACNUC7421 zone)

EMBL: FM180568.HOFC

FM180568.HOFC        Location/Qualifiers
FT   CDS_pept        complement(120520..121722)
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="E2348C_0109"
FT                   /product="assembly protein in type IV pilin biogenesis,
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07657"
FT                   /db_xref="GOA:B7UIF4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIF4"
FT                   /protein_id="CAS07657.1"
FT                   /translation="MASKQLWRWRGITGDGNAQDGMLWAESRALLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGVAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLASFSGEWGWLLVL
FT                   FGFLLAIANKLLMRHPTRLIARQKLLLRIPIMGSLMRGQKLTQIFTILTLTQSAGISFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     atggcgagta agcaactctg gcgctggcgt ggcataaccg gcgacggcaa tgcgcaagat        60
     gggatgctat gggcagagag ccgtgctttg ctgctcatgg cactacagca acagatggtt       120
     accccactaa gcctgaagcg aatcgccatc aattctgcgc agtggcgagg agataaaagc       180
     gcggaagtca ttcatcaact ggcgacgcta ctcaaagccg ggttaacgct ttctgaaggg       240
     ctggctctgc tggcggaaca gcatcccagt aagcagtggc aagcgttgct gcaatcactg       300
     gcgcacgatc ttgaacaggg cgttgccttt tccaatgcct tattaccctg gtcagaggta       360
     tttccgccgc tctatcaggc gatgatccgc acgggtgaac tgaccggtaa gctggatgaa       420
     tgctgctttg aactggcgcg tcagcaaaaa gcccagcgtc agttgaccga caaagtgaaa       480
     tcagcgttac gttatcccat tatcatttta gcgatggcaa tcatggtggt tgtggcaatg       540
     ctgcattttg ttctgccgga gtttgccgct atctataaga cctttaacac tccgctaccg       600
     gcgctaacgc aggggatcat gacgctggca agttttagtg gcgaatgggg ttggttgctg       660
     gtgctattcg gctttctgct ggcgatagcc aataagctgc tgatgcgcca cccaaccagg       720
     cttatcgcac ggcagaaatt gctgttacgc atcccgatta tgggttcact gatgcgggga       780
     caaaaactca cgcagatctt tacgattctg acgctgacac aaagtgcagg catttctttt       840
     ttacagggcg ttgagagcgt cagagaaaca atgcgctgcc cgtactgggt gcaacttctg       900
     acacaaatcc agcacgatat cagtaacggt caccccatct ggctggcgct aaaaaatgcc       960
     ggtgagttta gcccgctctg tttgcaatta gtgagaacag gagaggcatc cggctcgctg      1020
     gatctcatgt tagacaacct cgcccatcat catcgggata acacaatggc gctggcggat      1080
     aacctcgcag ccttactgga accggcgttg ctgatcataa cgggaggaat tatcggtacg      1140
     ctggtggtgg caatgtatct gccaattttc catttaggcg atgcgatgag tggaatggga      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page