(data stored in ACNUC7421 zone)

EMBL: FM180568.HOKC1

FM180568.HOKC1       Location/Qualifiers
FT   CDS_pept        complement(16852..17004)
FT                   /transl_table=11
FT                   /gene="hokC1"
FT                   /locus_tag="E2348C_0017"
FT                   /product="small toxic membrane peptide HokC 1"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07565"
FT                   /db_xref="GOA:B7UI62"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI62"
FT                   /protein_id="CAS07565.1"
FT                   /translation="MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRIGQTEVAVFT
FT                   AYESE"
     atgaagcagc ataaggcgat gattgtcgcc ctgatcgtca tctgtatcac cgccgtagtg        60
     gcggcgctgg taacgagaaa agacctctgt gaggttcaca tccgaattgg ccagacggag       120
     gttgctgttt tcacggctta cgaatccgag taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page