(data stored in ACNUC7421 zone)

EMBL: FM180568.HOKC2

FM180568.HOKC2       Location/Qualifiers
FT   CDS_pept        540252..540404
FT                   /transl_table=11
FT                   /gene="hokC2"
FT                   /locus_tag="E2348C_0483"
FT                   /product="small toxic membrane peptide HokC 2"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08031"
FT                   /db_xref="GOA:B7UKM5"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKM5"
FT                   /protein_id="CAS08031.1"
FT                   /translation="MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
     atgctgacga aatatgccct tgcggcagtc atagtgctgt gtttgacggt gctgggattt        60
     acgcttctgg tcggagactc gctgtgtgag tttacggtga aggaacgtaa tattgagttt       120
     aaggctgttc tcgcttacga accgaagaag tag                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page