(data stored in ACNUC7421 zone)

EMBL: FM180568.HOLA

FM180568.HOLA        Location/Qualifiers
FT   CDS_pept        complement(599361..600392)
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="E2348C_0540"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08088"
FT                   /db_xref="GOA:B7UKT0"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKT0"
FT                   /protein_id="CAS08088.1"
FT                   /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQ
FT                   GFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLL
FT                   HDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELD
FT                   DAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALL
FT                   MGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQN
FT                   RRGMMSEALNRLSQPQLRQAVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADIF
FT                   IDG"
     atgattcggt tgtacccgga acaactccgc gcgcagctca atgaagggct gcgcgcggcg        60
     tatcttttac ttggtaacga tcctctgtta ttgcaggaaa gccaggacgc tgttcgtcag       120
     gtcgctgcgg cgcaagggtt cgaagaacac cacacttttt ccattgatcc caacaccgac       180
     tggaatgcga ttttttcgtt atgccaggcc atgagcctgt ttgccagtcg acaaacgcta       240
     ttgctgttgt tacccgaaaa cggaccgaat gcggcgatca atgaacaact tctcacactc       300
     accggacttc tgcatgacga tctactgttg atcgtccgcg gtaataaatt aagcaaagcg       360
     caagaaaatg ccgcctggtt tactgctctt gcgaatcgca gcgtgcaggt gacctgtcag       420
     acaccggagc aggctcagct gccccgctgg gttgctgcgc gcgcaaaaca gctcaactta       480
     gaactggatg acgctgcaaa tcaggtgctc tgctactgtt atgaaggtaa cctgctggcg       540
     ctggcccagg cactggagcg tttatcgcta ctctggccgg acggcaaact gacattaccg       600
     cgcgttgaac aggcggtgaa tgatgccgcg catttcaccc cttttcattg ggttgatgct       660
     ttgttgatgg gaaaaagtaa gcgcgcgttg catattcttc aacaactgcg tctggaaggt       720
     agcgaaccgg ttattttgtt gcgcacatta caacgtgaac tgttgttact ggttaacctg       780
     aaacgccagt ctgcccatac gccactgcgt gcgttgtttg ataagcatcg ggtatggcag       840
     aaccgccggg gcatgatgag cgaggcgtta aatcgcttaa gccagccgca gttacgtcag       900
     gccgtgcaac tcctgacacg aacggaactc accctcaaac aagattacgg tcagtcagtg       960
     tgggcagagc tggaagggtt atctcttctg ttgtgccata aacccctggc ggacatattt      1020
     atcgacggtt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page