(data stored in ACNUC7421 zone)

EMBL: FM180568.HTRE

FM180568.HTRE        Location/Qualifiers
FT   CDS_pept        complement(158655..161243)
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="E2348C_0142"
FT                   /product="predicted outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07690"
FT                   /db_xref="GOA:B7UII4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B7UII4"
FT                   /protein_id="CAS07690.1"
FT                   /translation="MTIKSTNHLTHIATFCALLYSNSALCAELVEYDHTFLMGNDASNI
FT                   DLSRYTEGNPTLPGIYDVSVYINDQPIMSQSIAFTVIEGKKNAQACITQKNLLQFHISS
FT                   PDKNSGKAILLKRDDDLGDCLNLAEMISQSSIRYDVNDQRLDIDVPQAWIMKNYQNYVD
FT                   PSLWENGINAAMLSYNLNGYHSESPGRTNDSIYAAFNGGINLGAWRLRASGNYNWMTNV
FT                   HSDYDFQNRYLQRDLASLRSQLVIGESYTTGETFDSVSIRGIRLYSDSRMLPPVLASFA
FT                   PIIHGVANTNAKVTVMQNGYKIYETTVPPGAFAIDDLSPSGYGSDLIVTIEEADGTKRT
FT                   FSQPFSSVVQMLRPGVGRWDISAGQVLKDSIQDEPNLFQASYYYGLNNYLTGYTGIQLT
FT                   DNNYTAGLLGLGMNTPVGAFSVDVTHSNVSIPDDKTYQGQSYRISWNKLFENTSTSLNI
FT                   AAYRYSTQHYLGLNDALTLIDEVEHPEQDLEPKSMRNYSRMKNQVTVSINQPLKFEKKD
FT                   YGSFYLSGSWSDYWASGQNSTNYSIGYSNSASWGSYSISAQRSLNEDGQTDDSIYLSFT
FT                   IPIENLLDTDHRSSGFQSIDTQLNSDFKGNNQLNISSSGYSDTNRISYSVNTGYMMNKS
FT                   SDDLSYIGGHASYESPWGTLSCSASASSDNSRQFSLNTDGGFVLHSGGLTFSNDSFSDS
FT                   DTLAVIQALGAKGARINYGNSTVDRWSYGVTSALSPYHENRIALDINDLENDVELKSTS
FT                   TVAIPRQGAVVFADFETVQGQSAIMNIVRSDGKNIPFAEDIYDEQNNIIGNVGQGGQAF
FT                   VHGIEQEENIRITWIEEGKPVSCFAHYQQNTASEKIAQSIILNGLRCQIQ"
     gtgactatta aatccactaa tcatcttacc cacatcgcca cgttttgcgc tctgctgtat        60
     agcaatagtg ctttatgcgc tgaactcgtc gaatatgacc atacatttct gatgggaaac       120
     gatgcttcaa atatcgacct tagtcggtat acagaaggta acccgacact accaggcatt       180
     tacgatgtca gtgtgtatat taacgatcaa cccatcatga gccaaagcat tgcttttact       240
     gttattgaag gtaaaaagaa cgctcaggcc tgcattacgc agaaaaattt attgcaattt       300
     catatcagtt caccagacaa gaatagcgga aaagccattt tgcttaagcg agacgacgat       360
     cttggtgatt gcctcaatct ggctgaaatg atctctcaat catccattcg ttacgatgtt       420
     aacgatcaac gcctggatat cgacgtcccc caggcatgga ttatgaagaa ttatcaaaac       480
     tatgttgatc cctctttgtg ggaaaatggc attaatgcag ccatgctttc ctacaacctc       540
     aacggatatc acagtgaaag tccaggcaga acaaatgaca gtatctacgc ggcattcaac       600
     ggtgggataa acttaggtgc ctggcggtta cgtgcctcgg gtaactacaa ctggatgacc       660
     aatgtccata gcgattacga ttttcagaat cgctatttac aacgcgatct tgcgtcacta       720
     cgttcacaac tggttattgg tgaatcttac acgaccggcg agaccttcga ttcagtcagc       780
     attcgcggta ttcgcttata cagtgacagt cgaatgctgc ctccggtatt agccagtttt       840
     gcgccaatca ttcatggcgt agcgaatacc aatgccaaag taaccgttat gcaaaatggt       900
     tataaaatct atgaaacgac ggtgccgcca ggggcctttg ccattgacga tcttagcccg       960
     tcaggttatg gcagcgatct cattgtgact atcgaagaag ctgatggcac aaaacggacg      1020
     ttctcccagc cattttcatc tgttgtgcaa atgctgcgcc ctggcgttgg tcgctgggat      1080
     attagcgccg gtcaggtttt aaaagacagt atccaggatg agcctaattt atttcaagcc      1140
     agctactact atggtttgaa taactacctg acaggatata ccggtattca gctaactgat      1200
     aataactata ccgccggatt gctggggctt ggtatgaata cccccgtggg ggctttttct      1260
     gtcgatgtta ctcactcaaa tgtcagcatt ccggacgata aaacctatca aggacaaagc      1320
     taccgtattt cctggaacaa gttatttgaa aataccagta catcattaaa tatcgcggcc      1380
     tatcgctact ccacccagca ttatctgggc ctcaatgatg cgctgacgct gattgatgaa      1440
     gtagaacatc ctgagcaaga tcttgagcct aaatccatgc gcaattactc gcgcatgaaa      1500
     aatcaggtca cggtcagtat caaccaaccg ctgaaatttg agaaaaagga ttacggttca      1560
     ttttatctct cgggaagctg gtcagattac tgggcctccg ggcaaaacag tactaattac      1620
     tctattggtt atagcaatag tgcgtcctgg ggcagttaca gtatcagtgc tcaacgttcg      1680
     ttgaatgaag atggtcaaac cgacgatagc atttatctca gcttcacgat tccaatagaa      1740
     aatttactgg atacggatca ccgcagctcc ggcttccaga gtattgatac acaattaaac      1800
     agcgacttta agggtaataa ccaactcaat atcagcagta gtggttacag cgataccaat      1860
     cgcatcagct acagcgtaaa cacgggttat atgatgaata aatccagtga tgatttgagt      1920
     tatatcggcg gtcatgccag ttatgaatcg ccgtggggaa cgctgtcatg ttcagcctca      1980
     gcaagcagtg ataatagtcg ccaattctca ctcaatactg atggtggatt tgtgttacat      2040
     agcggcgggc tgacgttcag taatgacagt tttagtgatt ccgacactct ggctgtcatt      2100
     caggcgctag gagcaaaagg cgctcgtatt aactacggaa acagcaccgt agaccgctgg      2160
     agttatggtg tgaccagcgc cctttcgcca taccatgaaa atcgtatcgc actggacatt      2220
     aacgatctgg aaaacgatgt tgaattgaaa agcaccagta ctgtcgccat cccgcgccag      2280
     ggagccgtcg tctttgctga ttttgaaaca gttcagggac aatcggcaat tatgaatatc      2340
     gtgcgaagcg atggtaaaaa tattccattt gcggaggata tttatgatga acaaaacaat      2400
     atcatcggca acgtaggtca gggtggtcaa gcctttgttc acggcatcga acaggaagaa      2460
     aatatacgaa ttacctggat tgaagagggc aaaccagtca gttgttttgc tcattaccaa      2520
     caaaacacgg catcagaaaa aatagcacaa tctattattc ttaacgggct tcgttgtcag      2580
     atacagtaa                                                              2589
//

If you have problems or comments...

PBIL Back to PBIL home page