(data stored in ACNUC7421 zone)

EMBL: FM180568.ILVH

FM180568.ILVH        Location/Qualifiers
FT   CDS_pept        93474..93965
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="E2348C_0083"
FT                   /product="acetolactate synthase III, thiamin-dependent,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07631"
FT                   /db_xref="GOA:B7UIC8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIC8"
FT                   /protein_id="CAS07631.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     atgcgccgga tattatcagt cttactcgaa aatgaatcag gcgcgttatc ccgcgtgatt        60
     ggcctttttt cccagcgtgg ctacaacatt gaaagcctga ccgttgcgcc aaccgacgat       120
     ccgacattat cacgtatgac cattcagacc gtgggcgatg aaaaagtgct tgagcaaatc       180
     gaaaagcaat tacacaaact ggtcgatgtc ttgcgcgtga gcgagctggg gcagggggcg       240
     cacgtcgagc gggaaattat gctggtgaaa attcaggcca gcggctacgg acgtgacgaa       300
     gtgaagcgca atacggaaat atttcgtggg caaatcatcg atgtcacgcc atcgctttac       360
     accgtccaac tggcaggcac cagcgataag cttgatgcat ttttagcatc gattcgcgat       420
     gtggcgaaaa ttgtggaagt tgctcgctct ggtgtagttg gactttcgcg cggcgataaa       480
     ataatgcgtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page