(data stored in ACNUC7421 zone)

EMBL: FM180568.ILVI

FM180568.ILVI        Location/Qualifiers
FT   CDS_pept        91747..93471
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="E2348C_0082"
FT                   /product="acetolactate synthase III, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07630"
FT                   /db_xref="GOA:B7UIC7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIC7"
FT                   /protein_id="CAS07630.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTSGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESV
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTNGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPQELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     atggagatgt tgtctggagc cgagatggtc gtccgatcgc ttatcgatca gggcgttaaa        60
     caagtattcg gttatcccgg aggcgcggtc cttgatattt acgatgcatt gcataccgtg       120
     ggtggtatcg atcatgtttt agttcgtcat gagcaggcgg cggtgcatat ggccgatggt       180
     ctggcgcgcg cgaccgggga agtcggcgtc gtgctggtaa cgtcgggtcc aggggcgacc       240
     aatgcgatta ctggcattgc caccgcttat atggattcca ttcccttagt tgtcctttcc       300
     gggcaggtag cgacctcgtt gataggctac gatgcctttc aggagtgcga catggtgggg       360
     atttctcgcc cggtggttaa acacagtttt ctggttaagc aaacggaaga cattccgcag       420
     gtgctgaaaa aggctttctg gctggcggca agtggtcgcc ctgggcccgt ggtcgttgat       480
     ttacccaaag atattcttaa tccggcgaac aaattaccct acgtctggcc ggagtcggtc       540
     agtatgcgat cttacaatcc cacgacctcc gggcataaag ggcaaattaa gcgcgctctg       600
     caaacgctgg tggcggcaaa aaaaccggtt gtctatgtag gcggtggggc aatcacggcg       660
     ggctgtcatc agcagctaaa agaaacggtg gaggcgttga atctgcccgt tgtttcctca       720
     ttaatggggc tgggggcgtt tccggcaacg catcgtcagg ctctgggcat gctgggaatg       780
     cacggcacct acgaagctaa tatgacgatg cataacgcgg atgtgatttt tgccgtcggg       840
     gtacgttttg atgaccgaac gacgaacaat ctggcgaagt actgcccaaa tgccacggtt       900
     ctgcatatcg atattgatcc tacttccatt tctaaaaccg tgactgctga tatcccgatt       960
     gtgggggatg ctcgccaggt cctcgaacaa atgcttgaac tcctgtcgca agaatccgtc      1020
     catcaaccgc tggatgagat ccgcgactgg tggcagcaga ttgaacagtg gcgcgctcgt      1080
     cagtgcctga aatatgacac tcacagtgaa aagattaaac cgcaggcggt gatcgagact      1140
     ctttggcggt tgactaatgg ggacgcttac gtgacgtccg atgtcgggca gcaccagatg      1200
     tttgctgcgc tttattatcc attcgacaaa ccgcgtcgct ggatcaactc tggcggcctc      1260
     ggcacgatgg gttttggttt acctgcggca ctgggcgtca aaatggcgtt gccagaagaa      1320
     accgtggttt gcgtcactgg tgacggcagt attcagatga atatccagga actgtctacc      1380
     gcgttgcaat atgagttgcc cgtactggtg gtgaatctca ataaccgcta tctggggatg      1440
     gtgaagcagt ggcaggacat gatctattca ggccgtcatt cacaatctta tatgcagtcc      1500
     ttaccagact tcgtccgtct ggcggaagcc tatggtcacg tcgggatcca gatctctcat      1560
     ccgcaagaac tggaaagcaa acttagcgag gcgctggaac aggtgcgcaa taatcgcctg      1620
     gtgtttgttg atgttaccgt cgatggcagt gagcacgtct acccgatgca gattcgcggg      1680
     ggcggaatgg atgaaatgtg gttaagcaaa acggagagaa cctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page