(data stored in ACNUC7421 zone)

EMBL: FM180568.KDPB

FM180568.KDPB        Location/Qualifiers
FT   CDS_pept        complement(653724..655772)
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="E2348C_0586"
FT                   /product="potassium translocating ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08134"
FT                   /db_xref="GOA:B7UKX6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKX6"
FT                   /protein_id="CAS08134.1"
FT                   /translation="MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLL
FT                   TTCISIAMASGVMPGNALFSAAISGWLWVTVLFANFAEALAEGRSKAQANSLKGVKKTA
FT                   FARKLREPKYGAAADKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESA
FT                   PVIRESGGDFASVTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALT
FT                   ILLIALTIVFLLATATLWPFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSR
FT                   MLGANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKALADAAQLA
FT                   SLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVD
FT                   AIRRHVEANGGHFPADVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFA
FT                   QLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTG
FT                   DGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLT
FT                   TFSIANDVAKYFAIIPAAFAATYPQLNALNIMRLHSPDSAILSAVIFNALIIVFLIPLA
FT                   LKGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLTVCGLV"
     atgagtcgta aacaactggc gctattcgaa ccaacacttg tcgttcaggc gctgaaagaa        60
     gcggtgaaaa aattaaaccc gcaggcgcaa tggcgcaatc cggtgatgtt tatcgtctgg       120
     atcggcagtc tgctgaccac ctgtattagc atcgcgatgg caagcggtgt gatgcctggc       180
     aatgcgctgt ttagcgcggc aattagcggc tggctgtggg tcaccgtact gttcgctaat       240
     ttcgccgagg cgttggcaga aggccgcagt aaagcgcagg ccaacagtct gaaaggggtg       300
     aaaaaaaccg cttttgctcg caagctgcgc gaaccgaaat atggcgctgc ggcagacaaa       360
     gttcctgccg atcaactgcg taaaggcgat atcgtactgg tagaagctgg cgatattatc       420
     ccctgcgatg gtgaagtcat tgaaggcggc gcatcggtcg atgaaagcgc catcaccggg       480
     gaatcggctc cggtgatccg tgaatccggc ggtgattttg cctccgtcac tggcggcacg       540
     cgtattcttt ctgactggct ggtgattgag tgcagcgtta accccggcga gacatttctg       600
     gatcggatga tcgcgatggt ggaaggtgcg cagcgacgta aaacgccgaa cgagattgcc       660
     ctgaccattc tcctgattgc cctgactatc gtctttttac tggcaaccgc cacgctgtgg       720
     ccgttttccg cgtggggcgg taatgcagtc agcgtaacgg tactggtggc actgctggtc       780
     tgtctgatcc caaccactat tggcggcctg ttgtcagcga ttggcgtcgc cgggatgagt       840
     cggatgctgg gcgcgaatgt gattgccacc agcgggcgag cagttgaagc agcgggtgat       900
     gttgacgttc tgctgctgga taaaaccggc accatcaccc tcggtaaccg tcaggcgtca       960
     gagtttatcc ccgcacaagg cgtggaggaa aaagcgctgg ccgacgccgc acaactggct      1020
     tcgctggctg atgaaacgcc ggaaggccgc agtattgtga tcctcgccaa gcagcgtttt      1080
     aacctgcgcg agcgcgatgt gcagtcgctc catgccacct ttgtaccttt tactgcacaa      1140
     agccggatga gcgggatcaa catcgacaac cgcatgatcc gtaaaggttc tgtcgatgcc      1200
     attcgccgcc atgttgaggc taacggcggt cacttccctg ccgatgttga tcaaaaagtc      1260
     gatcaggttg cgcgtcaggg agccacgccg ctggtggtgg tggaaggttc tcgtgtgctg      1320
     ggcgttattg cgctgaaaga tatcgtcaaa ggcggtatta aagagcgctt cgcgcagctg      1380
     cgtaaaatgg gcattaaaac ggtgatgatt accggcgata accgcctgac tgccgccgcg      1440
     atagctgcgg aagcgggtgt cgatgatttt ctcgccgaag caacaccgga ggccaagctg      1500
     gcactgattc gtcagtatca ggcggaaggc cgtttagtgg cgatgaccgg cgatggcacc      1560
     aacgatgctc cggcgctggc acaggccgat gttgcggtgg cgatgaactc cggcacccag      1620
     gcggcgaaag aagcgggcaa tatggtggat ctcgactcca acccgaccaa gttgatcgag      1680
     gtagtgcaca ttggcaaaca gatgctgatg acccgtggct cgttgaccac cttcagcatt      1740
     gccaacgatg tggcgaaata cttcgccatt attccagcgg cgttcgcggc aacgtatccg      1800
     cagttaaatg cgctgaacat catgcgcctg cattcgcccg actccgccat tctcagtgcg      1860
     gtcattttca acgccttgat tatcgtcttt ttgattcccc tggcgttaaa aggcgtgagt      1920
     tataaaccgc ttaccgcttc tgccatgttg cgccgtaact tatggattta cggtctgggt      1980
     gggctgctgg tgccgtttat tggtatcaaa gtcattgatt tactgctaac cgtttgcggt      2040
     ctggtgtga                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page