(data stored in ACNUC7421 zone)

EMBL: FM180568.KDPC

FM180568.KDPC        Location/Qualifiers
FT   CDS_pept        complement(653143..653715)
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="E2348C_0585"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08133"
FT                   /db_xref="GOA:B7UKX5"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKX5"
FT                   /protein_id="CAS08133.1"
FT                   /translation="MRGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAE
FT                   LRAANPDASTNVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
     atgcgtggat tacgtccggc attatcgaca tttctctttc tgttattgat tactggcggc        60
     gtttacccgc tgctgaccac cgcactgggg caatggtggt ttccctggca ggccaacggt       120
     tcattgattc gtgaaggtga tacggtgcgc ggttcggcat taatcgggca aaattttacc       180
     ggcaacggct attttcatgg tcgcccgtcg gcaacagcag aaatgcccta taatccacag       240
     gcttctggcg ggagcaacct ggcggtcagt aacccggagc tggataaaca gatagccgca       300
     cgcgttgctg aattacgggc tgctaacccg gatgccagca cgaacgttcc ggttgaactg       360
     gtgacggcgt cagcaagcgg gctggacaat aacatcaccc cgcaagcggc ggcctggcag       420
     atcccacgcg tggcgaaagc gcgtaatctc agcgttgaac agctcacgca actgatcgca       480
     aaatacagcc aacaaccgct ggtgaaatat atcggccagc cggtcgtcaa cattgtcgaa       540
     ctcaatctgg cactggataa gcttgatgaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page