(data stored in ACNUC7421 zone)

EMBL: FM180568.KDPD

FM180568.KDPD        Location/Qualifiers
FT   CDS_pept        complement(650466..653150)
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="E2348C_0584"
FT                   /product="fused sensory histidine kinase KdpD in
FT                   two-component regulatory system with KdpE signal sensing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08132"
FT                   /db_xref="GOA:B7UKX4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKX4"
FT                   /protein_id="CAS08132.1"
FT                   /translation="MNNEPLRPDPDRLLEQAAAPHRGKLKVFFGACAGVGKTWAMLAEA
FT                   QRLRAQGLDIVVGVVETHGRKDTAAMLKGLAVLPLKRQAYRGRHISEFDLDAALARRPA
FT                   LILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVR
FT                   ETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELA
FT                   LRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVW
FT                   HAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLSDPAEEKAVVRYAREHNLGKI
FT                   ILGRPASRRWWRRETFADRLARIAPDLDQVLVALDEPPARTINNAPDSRSFKDKWRVQI
FT                   QGCVVAAALCAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVS
FT                   FDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYE
FT                   MSKALAVGRSSQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQ
FT                   WSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFT
FT                   LLVANALERLTLTASEEQARMASEREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLA
FT                   SEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLE
FT                   PGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGINAHVEGENLQL
FT                   DVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEG
FT                   GACFRVTLPQQTAPELEEFHEDM"
     atgaataacg aacccttacg tcccgacccc gatcgtctgc tggaacaagc tgccgcgccg        60
     catcggggga agctgaaagt attcttcggt gcctgcgcag gcgtcgggaa gacttgggcg       120
     atgctggcgg aagcccagcg actgcgggcg caagggctgg atattgtggt tggcgtggta       180
     gaaacccacg gtcggaaaga taccgccgcc atgctgaaag gtctggctgt tctgccgtta       240
     aaacgccagg cgtaccgtgg gcggcacatc agcgagtttg atctcgatgc cgccctcgcc       300
     cgccgtccgg cactgatctt aatggacgaa ctggcgcaca gtaatgcgcc aggttcacgt       360
     catcctaaac gctggcagga catcgaagag ctgctggaag ctggcattga tgttttcact       420
     accgtcaacg ttcagcatct ggaaagtctg aatgatgtgg tcagcggcgt caccggaatt       480
     caggtacggg agaccgtgcc cgatcctttt tttgatgccg ccgacgacgt agtactggtg       540
     gacttgcccc cggacgatct gcgccagcgg ctgaaagaag gcaaagtcta tattgccggg       600
     caagcggagc gcgccattga acattttttt cgcaaaggca atctgatcgc cctgcgcgaa       660
     ctggcactgc gccgtactgc cgatcgcgta gatgagcaaa tgcgcgcctg gcgggggcat       720
     cctggcgaag agaaagtctg gcacacacgc gacgcgatcc tattatgcat cgggcataac       780
     accggcagtg agaaactggt ccgcgcggcg gcgcggttgg cctcgcgcct gggcagtgtc       840
     tggcacgcgg tgtatgttga aacccctgcc ctgcatcgct taccggagaa aaaacgtcgg       900
     gcaattctca gcgccttacg tctggcgcag gagctgggcg cggagacggc aacactttct       960
     gatccagcgg aagagaaagc ggtagtgcgt tatgcccgtg aacataatct cggcaagatt      1020
     attctcggtc gcccggcttc gcgccgctgg tggcgtcggg aaacatttgc tgaccggctg      1080
     gcacgcatcg cccccgatct cgatcaggtg ctggtcgcgc ttgatgaacc acccgcccgc      1140
     acgattaaca acgcgccgga tagccgctct tttaaagaca agtggcgggt acagattcag      1200
     ggatgcgtgg ttgccgccgc gttatgcgcc gttatcacct taattgccat gcagtggctg      1260
     atggcgtttg atgccgccaa cctggtgatg ctgtatctgc ttggcgtcgt ggtggtggca      1320
     ctattttacg gacgctggcc ttcggtggtt gccaccgtca ttaatgtggt gagtttcgat      1380
     ctctttttta tcgccccacg cggcacgctc gccgtctctg atgtgcaata tctgctgacc      1440
     ttcgcggtga tgttaaccgt cgggctggtg atcgggaacc ttactgctgg cgtgcgttat      1500
     caggcgcggg tagcccgtta ccgcgaacaa cgcacacggc acttatatga aatgtccaaa      1560
     gctctggctg tgggccgtag ttcgcaggat atcgccgcca ccagcgaaca gtttattgcc      1620
     tccacgtttc atgcccgtag ccaggtgttg ctgcctgatg acaacggtaa attgcagcct      1680
     ttaacacatc cgcaaggaat gacgccgtgg gacgatgcca tcgcgcagtg gagttttgat      1740
     aaaggcctgc ctgcgggcgc gggcaccgac acgttacccg gtgtaccgta ccagattttg      1800
     ccgctaaaaa gcggcgagaa aacctacgga ctggtggtgg tggaaccggg gaatctgcgc      1860
     cagttgatga tcccggaaca gcagcgcctg ctggagacgt ttacgctgtt agtcgccaat      1920
     gcccttgagc gactgacact gaccgccagc gaagaacagg cgcggatggc aagcgaacgt      1980
     gaacagatcc gcaacgccct gctggcggcg ctttcgcatg atttacgcac gccgcttacg      2040
     gtgctgttcg gtcaggcaga aatcttaacg ctcgatctgg caagcgaagg atcgccccac      2100
     gcccgccagg ccagcgagat tcgtcagcat gtgctgaaca ccacccgact ggtgaataat      2160
     ctactggata tggcgcgaat tcagtccggc ggctttaatt tgaagaaaga gtggttaacg      2220
     ctggaagaag tggtcggcag cgcgctgcaa atgctggaac cgggtttatc gtcgcccatc      2280
     aatctttctc tgccagagcc gctgacctta atccacgttg acgggccact ctttgaacgg      2340
     gtgctgatta acctgctgga gaacgcggtg aaatatgcgg gggcgcaggc cgaaattggt      2400
     atcaatgccc acgttgaggg cgaaaatcta caactggatg tctgggataa cggccccggt      2460
     cttccaccag gccaggagca gacgatattt gataagtttg ctcgcgggaa taaagagtcg      2520
     gcggtaccgg gtgtagggct tgggttggca atttgtcggg cgatagtgga tgtacacggc      2580
     ggcaccatta ccgcattcaa ccgaccggaa ggtggtgcct gttttcgtgt tacacttccc      2640
     cagcaaacag cccctgaact tgaagaattt catgaggata tgtga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page