(data stored in ACNUC7421 zone)

EMBL: FM180568.KEFA

FM180568.KEFA        Location/Qualifiers
FT   CDS_pept        447013..450375
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="E2348C_0400"
FT                   /product="fused conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07948"
FT                   /db_xref="GOA:B7UKE5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKE5"
FT                   /protein_id="CAS07948.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRVKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQVQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATQNGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVSKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQTLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNATEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
     atgactatgt tccagtatta caaacgatca cggcattttg ttttttcagc atttattgct        60
     tttgtttttg tcttgttatg ccagaacacg gcgtttgcac gggcgtcatc gaatggtgat       120
     ttaccgacaa aagcggacct gcaggcacaa cttgactcac tgaataaaca aaaagatctt       180
     tctgctcagg acaaactggt gcagcaggat ctgacagata cattagccac cctcgataaa       240
     atcgatcgcg taaaagaaga gacagttcag ctacggcaaa aagtcgctga agcgccggaa       300
     aaaatgcgcc aggcgaccgc ggcgttaaca gcacttagtg atgtcgataa cgacgaagaa       360
     acgcgcaaaa ttctgagcac gctttcgttg cgccagctgg aaactcgcgt tgcccaggcg       420
     ctggacgatt tgcaaaacgc acaaaacgat ctggcgtctt ataacagcca actggtttcg       480
     ctacagacgc agcccgaacg cgtacaaaat gcgatgtata acgcttcgca gcagctgcaa       540
     caaattcgca gtcgtctgga tgggactgat gtcggcgaga ctgccttacg tcccagccag       600
     aaagtgttaa tgcaggtcca gcaggctttg ctgaatgccg agattgacca gcagcgtaaa       660
     agcctggaag ggaacactgt cttgcaggat accttgcaaa agcagcgtga ttacgtgacg       720
     gcgaacagcg cccgtctgga gcaccagtta caactgttgc aagaagcggt aaacagcaag       780
     cgcctgactt taaccgaaaa aacggcgcag gaagctgtct ccccggatga agccgcgcgt       840
     attcaggcta atccgctggt gaagcaggaa ctggaaatta accagcagtt aagtcagcgt       900
     ctgattaccg cgactcaaaa cggtaatcag ttgatgcagc aaaacattaa agtcaaaaac       960
     tggctggagc gtgcgctgca atcggaacgt aatattaagg agcagattgc cgttctgaag      1020
     ggcagtctgc tgttgtcacg tatcctgtac cagcaacaac aaacactccc ctcggcagat      1080
     gaactggaaa acatgaccaa ccgcatcgcg gatttgcgtc tcgaacagtt tgaagtcaac      1140
     cagcagcgtg acgcgctgtt ccagagcgat gcgttcgtca gcaaactgga agaaggtcac      1200
     accaacgaag tcaacagcga agttcacgat gcattattgc aagtagttga tatgcgtcgc      1260
     gaattgctgg atcagcttaa caaacagttg ggtaaccagc tgatgatggc cattaacctg      1320
     caaatcaacc agcagcagtt aatgagtgtg tcgaaaaacc tgaaatccat cctgacgcag      1380
     caaatttttt gggtgaacag taaccgcccg atggactggg actggattaa agcgttcccg      1440
     caaacgctga aagatgaatt taagtcgatg aaaatcacgg tgaactggga aaaagcctgg      1500
     cccgccgtat tcatcgcctt cctcgctggt ttgccgctgc tgttgattgc cgggctgatc      1560
     cactggcgtc tgggctggct gaaagcgtat caacaaaaac tggcttccgc tgtgggttcc      1620
     ctgcgtaacg acagccagct caacacacca aaagcgatcc ttatcgacct gatccgcgca      1680
     ctgccggtgt gcctgattat tctcgctgtc ggcctgattc tgctgactat gcagctcaat      1740
     atcagcgagt tattgtggtc gttcagcaaa aaactggcga ttttctggct ggtatttggc      1800
     ctgtgctgga aagtgctgga gaaaaatggt gttgccgtgc gtcactttgg tatgccggaa      1860
     cagcagacca gccactggcg tcggcaaatt gtccgcatca gcctcgcgtt gctgccgatc      1920
     catttctggt ctgtggtggc agaactctcc ccgctgcatt tgatggatga tgtgctgggg      1980
     caggcgatga ttttcttcaa cctgctgctg attgccttcc tggtgtggcc gatgtgccgc      2040
     gaaagctggc gtgataaaga gtcgcacacc atgcgactgg tcaccattac cgtgctgtcg      2100
     attatcccga ttgcgttgat ggtgctgacc gccacgggtt acttctacac cacgctgcgc      2160
     ctctccgggc gttggattga aaccgtttat ttggtgatca tctggaacct gctgtaccag      2220
     acggtattgc gcggcttaag cgtagcggcg cggcgtatcg cctggcgtcg tgcactggcg      2280
     cgtcggcaga atctggtgaa agagggcgca gaaggtgccg aaccgccgga agaacccacc      2340
     attgcgctgg agcaggttaa ccagcagacg ctgcgtatta ccatgttgct gatgtttgcg      2400
     ctgttcggtg tcatgttctg ggcaatttgg tctgatttga tcaccgtgtt cagctatctc      2460
     gacagcatta cgctctggca ttacaacgct actgaagctg gtgctgcggt ggtgaaaaac      2520
     gtcaccatgg gcagtctgtt gtttgcgatt atcgcctcaa tggtggcctg ggcgttgatt      2580
     cgcaacctgc ctggtttgct ggaagtgctg gtgctctcgc gactgaatat gcgccagggc      2640
     gcgtcgtatg ccattactac catccttaac tacatcatta ttgccgttgg tgcgatgacg      2700
     gtgttcggat cgctgggcgt ctcgtgggat aaactccagt ggctggcggc agcattatcc      2760
     gtaggtcttg gttttggttt acaagagatc ttcggtaact tcgtttccgg tttgatcatt      2820
     ctgttcgaac gtccggtgcg cataggcgac acggtaacca ttggtagctt ctcgggtacg      2880
     gtcagcaaga tccgtattcg tgcgacaacg attaccgatt tcgatcgcaa agaagtgatt      2940
     atcccgaaca aagcgtttgt taccgagcgt ctgatcaact ggtcgttgac tgacacgact      3000
     acgcgtctgg tgatccgtct cggcgtagcc tatggctccg atctggaaaa agtgcgtaaa      3060
     gtgttgctga aggcggcgac tgagcaccca agggtgatgc acgaaccaat gccggaagtc      3120
     ttctttacgg catttggtgc cagcacgttg gatcatgagc tgcgtctgta tgtgcgtgaa      3180
     ctgcgtgacc gtagccgtac tgtcgatgag ctgaaccgta ctatcgatca gctgtgccgt      3240
     gaaaacgaca tcaacattgc ctttaaccag cttgaagtgc atctgcacaa cgagaagggc      3300
     gatgaagtga cggaagtgaa acgcgactac aaaggcgacg atccgacgcc agcggtaggg      3360
     taa                                                                    3363
//

If you have problems or comments...

PBIL Back to PBIL home page