(data stored in ACNUC7421 zone)

EMBL: FM180568.KEFF

FM180568.KEFF        Location/Qualifiers
FT   CDS_pept        50122..50652
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="E2348C_0047"
FT                   /product="flavoprotein subunit for the KefC potassium
FT                   efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07595"
FT                   /db_xref="GOA:B7UI92"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI92"
FT                   /protein_id="CAS07595.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
     atgattctta taatttatgc gcatccatat ccgcatcatt cccatgcgaa taaacggatg        60
     cttgaacagg caaggacgct ggaaggcgtc gaaattcgct ctctttatca actctatcct       120
     gacttcaata tcgacattgc cgccgaacag gaggcgctgt ctcgtgccga tctgatcgtc       180
     tggcagcacc cgatgcagtg gtacagcatt cctccgctcc tcaaactttg gatcgataaa       240
     gttttctcgc acggatgggc ttacggtcac ggcggcacgg cgctgcacgg caaacatttg       300
     ctgtgggcgg tgacgaccgg cggcggggaa agccattttg agattggtgc gcatccgggg       360
     tttgatgtgc tgtcgcagcc gctacaggcg acggcaatct actgcgggct gaactggctg       420
     ccaccgtttg ccatgcactg cacctttatt tgtgacgacg aaaccctcga agggcaggcg       480
     cggcactata agcaacgtct gctggaatgg caggaggcac atcatggata g                531
//

If you have problems or comments...

PBIL Back to PBIL home page