(data stored in ACNUC7421 zone)

EMBL: FM180568.LEUC

FM180568.LEUC        Location/Qualifiers
FT   CDS_pept        complement(85582..86982)
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="E2348C_0077"
FT                   /product="3-isopropylmalate isomerase subunit, dehydratase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07625"
FT                   /db_xref="GOA:B7UIC2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIC2"
FT                   /protein_id="CAS07625.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEMSPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
     atggctaaga cgttatacga aaaattattc gacgctcacg tagtgtacga agccgaaaac        60
     gaaaccccgc tgttatatat cgaccgccac ctggtgcatg aagtgacctc accgcaggcg       120
     ttcgatggtc tgcgcgccca cggtcgcccg gtacgtcagc cgggcaaaac cttcgccacc       180
     atggatcaca acgtctctac ccagacgaaa gacattaatg cctgcggtga aatggcgcgc       240
     atccagatgc aggagctgat caaaaactgc aaagaatttg gcgtcgagct gtatgacctg       300
     aatcacccgt atcaggggat cgtccacgta atggggccgg aacagggcgt gaccttgccg       360
     gggatgacca ttgtctgcgg cgactcacat accgccaccc acggcgcgtt tggcgcactg       420
     gcctttggta tcggcacttc cgaagttgaa cacgtactgg caacgcaaac cctgaaacag       480
     ggccgggcga agaccatgaa aattgaagtc cagggcaaag ccgcgccggg cattacagcg       540
     aaagatatcg tgctggcgat tatcggtaaa actggtagcg caggcggcac cgggcatgtg       600
     gtggagtttt gcggcgaagc aatccgtgat ttaagcatgg aaggtcgtat gaccctgtgc       660
     aatatggcaa tcgaaatggg cgcgaaagcc ggtctggttg caccggacga aactaccttt       720
     aactatgtca aaggccgtct gcatgcgccg aaaggcaaag atttcgacga cgccgttgcc       780
     tactggaaaa ctctgcaaac cgacgaaggc gcaactttcg ataccgttgt gactttgcag       840
     gcagaagaaa tgtcaccgca ggtcacctgg ggcaccaatc caggtcaggt gatttccgtg       900
     aacgacaaca ttcccgatcc ggcttcgttt gccgatccgg ttgaacgcgc gtcggcagaa       960
     aaagcgctgg cctatatggg gctgaaaccg ggtattccgc tgacagaagt ggctatcgac      1020
     aaagtgttta tcggttcctg cactaactcg cgtattgaag atttacgcgc ggcagctgaa      1080
     atcgccaaag ggcgaaaagt cgcgccaggc gtgcaggcac tggtggttcc cggctctggc      1140
     ccggtaaaag cccaggcgga agcggaaggt ctggataaaa tctttattga agccggtttt      1200
     gaatggcgct tgcctggctg ctcaatgtgt ctggcgatga ataacgaccg tctgaatccg      1260
     ggcgaacgtt gtgcctccac cagtaaccgt aactttgaag gccgccaggg gcgcggcggg      1320
     cgcacgcatc tggtcagccc ggctatggct gccgccgctg cggtgaccgg acatttcgcc      1380
     gacattcgca acattaaata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page