(data stored in ACNUC7421 zone)

EMBL: FM180568.LEUD

FM180568.LEUD        Location/Qualifiers
FT   CDS_pept        complement(84966..85571)
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="E2348C_0076"
FT                   /product="3-isopropylmalate isomerase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07624"
FT                   /db_xref="GOA:B7UIC1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIC1"
FT                   /protein_id="CAS07624.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVQANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIASYEEKQPAFMR"
     atggcagaga aatttatcaa acacacaggc ctggtggttc cgctggatgc cgccaatgtc        60
     gataccgatg caatcatccc gaaacagttt ttgcagaaag tgacccgtac gggttttggc       120
     gcgcatctgt ttaacgactg gcgttttctg gatgaaaaag gccaacagcc aaacccggac       180
     ttcgtgctga acttcccgca gtatcagggc gcttccattt tgctggcacg agaaaacttc       240
     ggctgcggtt cctcgcgtga gcacgcgccg tgggcattga ccgattacgg ttttaaagtg       300
     gtgattgcac cgagttttgc tgacatcttc tacggcaaca gctttaacaa ccagctgctg       360
     ccggtgaaat taagcgacgc agaagtggac gaactgtttg cgctggtgca ggccaatccg       420
     gggattcatt ttgatgtaga cctggaagcg caagaggtga aagcgggaga gaaaacttat       480
     cgctttacca tcgatgcctt ccgccgccac tgcatgatga acggtctgga cagcattggc       540
     ctgaccctgc agcacgacga cgcaattgcg tcttatgaag agaagcaacc ggcgtttatg       600
     cgttag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page