(data stored in ACNUC7421 zone)

EMBL: FM180568.LPD

FM180568.LPD         Location/Qualifiers
FT   CDS_pept        133794..135218
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="E2348C_0119"
FT                   /product="lipoamide dehydrogenase, E3 component is part of
FT                   three enzyme complexes"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07667"
FT                   /db_xref="GOA:B7UIG4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIG4"
FT                   /protein_id="CAS07667.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIW
FT                   DSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
     atgagtactg aaatcaaaac tcaggtcgtg gtacttgggg caggccccgc aggttactcc        60
     gctgccttcc gttgcgctga tttaggtctg gaaaccgtaa tcgtagaacg ttacaacacc       120
     cttggcggtg tttgcctgaa cgtcggctgt atcccttcta aagcactgct gcacgtagca       180
     aaagttatcg aagaagccaa agcgctggct gaacacggta tcgtcttcgg cgaaccgaaa       240
     accgatatcg acaagattcg tacctggaaa gagaaagtga tcaatcagct gaccggtggt       300
     ctggctggta tggcgaaagg ccgcaaagtc aaagtggtca acggtctggg taaattcacc       360
     ggggctaaca ccctggaagt tgaaggtgag aacggtaaaa ccgtgatcaa cttcgacaac       420
     gcgatcattg cagcgggttc tcgcccgatt caactgccgt ttattccgca tgaagatccg       480
     cgtatctggg actccactga cgcgctggaa ctgaaagaag taccagaacg cctgctggta       540
     atgggtggcg gtatcatcgg tctggaaatg ggcaccgtat accacgcgct gggttcacag       600
     attgacgtgg ttgaaatgtt cgaccaggtc atcccggcag ctgataaaga catcgttaaa       660
     gtctttacca agcgtatcag caagaaattc aacctgatgc tggaaaccaa agttaccgcc       720
     gttgaagcga aagaagacgg catttatgtg acgatggaag gcaaaaaagc acccgctgaa       780
     ccgcagcgtt acgacgccgt gctggtagcg attggtcgtg tgccgaacgg taaaaacctc       840
     gacgcaggca aagctggtgt ggaagttgac gaccgtggtt tcatccgcgt tgacaaacag       900
     ctgcgtacca acgtaccgca catctttgct atcggcgata tcgtcggtca gccaatgctg       960
     gcacacaaag gtgttcacga aggtcacgtt gccgctgaag ttatcgccgg taaaaaacat      1020
     tacttcgatc ccaaagttat cccgtccatc gcctataccg aaccagaagt tgcatgggta      1080
     ggtctgactg agaaagaagc gaaagagaaa ggcatcagct acgaaaccgc caccttcccg      1140
     tgggctgctt ctggtcgtgc tatcgcttcc gactgcgcag acggtatgac caagctgatt      1200
     ttcgacaaag aatctcaccg tgtgatcggt ggtgcgattg tcggcactaa cggcggcgag      1260
     ttgctgggtg aaatcggcct ggcaatcgaa atgggttgtg acgctgaaga cattgcactg      1320
     accatccatg cgcacccgac tctgcacgag tctgtgggcc tggcggcaga agtgttcgaa      1380
     ggtagcatta ccgacctgcc gaacccgaaa gcgaagaaga agtaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page