(data stored in ACNUC7421 zone)

EMBL: FM180568.MAK

FM180568.MAK         Location/Qualifiers
FT   CDS_pept        369297..370205
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="E2348C_0330"
FT                   /product="manno (fructo) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07878"
FT                   /db_xref="GOA:B7UJL8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJL8"
FT                   /protein_id="CAS07878.1"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVPQLIKQFVFGGECETPV
FT                   HKAKHGDSSGVRGAAWLWPQE"
     gtgcgtatag gtatcgattt aggcggcacc aaaactgaag tgattgcatt gggcgatgca        60
     ggggagcagt tgtaccgcca tcgtctgccc acgccgcgtg atgattaccg gcagactatt       120
     gaaacgatcg ccacgttggt tgatatggcg gagcaggcaa cagggcagcg cggaacggta       180
     ggtatgggca ttccaggttc gatttcgccc tacaccggcg tggtgaagaa tgccaattca       240
     acctggctca acggtcagcc attcgataaa gacttaagcg cgcggttgca gcgggaagtg       300
     cggctggcaa atgacgccaa ctgtctggcg gtttcagaag cggtagatgg cgcggcagcg       360
     ggagcgcaga cggtatttgc cgtgattatc ggcacgggat gcggcgcggg cgtggcattc       420
     aatgggcggg cgcatatcgg tggcaatggc acggcaggcg agtggggaca caatccgcta       480
     ccgtggatgg acgaagacga actgcgttat cgcgaggaag tcccttgtta ttgcggtaaa       540
     caaggttgta ttgaaacctt tatttcaggc acgggattcg cgacggatta tcgtcgtttg       600
     agcggacatg cgctgaaagg cagtgaaatt atccgcctgg ttgaagaaag cgatccggta       660
     gcggaactgg cattgcgtcg ctacgagctg cggctggcaa aatcgctggc acatgtcgtg       720
     aatattctcg atccggatgt gattgtcctg ggcggcggaa tgagcaatgt agaccgttta       780
     tatcaaacgg ttccgcagtt gattaaacaa tttgtcttcg gcggagaatg tgaaacgccg       840
     gtacacaagg cgaaacatgg tgattcgagc ggcgtacgcg gcgctgcgtg gttatggcca       900
     caagagtaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page