(data stored in ACNUC7421 zone)

EMBL: FM180568.MBHA

FM180568.MBHA        Location/Qualifiers
FT   CDS_pept        257206..257991
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="E2348C_0225"
FT                   /product="flagellar system protein MbhA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07773"
FT                   /db_xref="GOA:B7UJC0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC0"
FT                   /protein_id="CAS07773.1"
FT                   /translation="MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPTHP
FT                   PKPATVAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIVRDAHMEANLEMEIV
FT                   PQGLRVLIKDDQNRNMFERGSAKIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKS
FT                   NIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMV
FT                   LTKSASDTLYQYFGQHGDKVVQPLVKKLDKQQVLSHRTR"
     gtgacgacaa taaagttgat agtgaacagc gtcagtaaat ccgagcgtga aagcattatc        60
     gccgcgctgc acgggcagtc gattttcaat ggcggcgggc tgtcgccgtt aaataaaatc       120
     agcccgacgc atccgccgaa acctgccacc gtggcggtgc cggaagagac ggagaaaaaa       180
     gcgcgcgacg tcaacgagaa aacggcgcta ctgaagaaga agtccgccac tgagcttggc       240
     gagctggcga ccagtatcaa caccatcgtc cgcgatgcgc atatggaagc caatctggag       300
     atggagattg ttccgcaggg attacgcgtg ctgattaaag atgaccagaa ccgcaatatg       360
     tttgaacgcg gcagcgcgaa gattatgccg ttctttaaaa cgctgctggt ggaactcgcg       420
     ccggtattcg actcgctcga caacaaaatt attattaccg ggcataccga tgcgatggcc       480
     tataaaagca atatctacaa caactggaac ctttcgggtg accgcgcgct ttcggctcgt       540
     cgggtactgg aagaggccgg gatgccggaa gataaagtga tgcaggtgag cgcaatggcg       600
     gaccagatgc tgctggacgc gaaaaatccg caaagtgcgg gtaaccggcg cattgagatt       660
     atggtgctca ccaaaagcgc gtccgatacg ttgtatcaat attttggtca gcatggggat       720
     aaggtggtgc agccgctggt gaaaaagctg gataagcagc aggtgctttc gcaccgaacg       780
     cgttaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page