(data stored in ACNUC7421 zone)

EMBL: FM180568.METI

FM180568.METI        Location/Qualifiers
FT   CDS_pept        complement(230923..231576)
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="E2348C_0204"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07752"
FT                   /db_xref="GOA:B7UJA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJA0"
FT                   /protein_id="CAS07752.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTISAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
     atgtctgagc cgatgatgtg gctgctggtt cgtggcgtat gggaaacgct ggcaatgacc        60
     ttcgtatccg gtttttttgg ctttgtgatt ggtctgccgg ttggcgttct gctttatgtc       120
     acgcgtccgg ggcaaattat tgctaacgcg aagttgtatc gtaccatttc tgcgattgtg       180
     aacattttcc gttccatccc gttcattatc ttgctggtat ggatgattcc gtttacccgc       240
     gttattgtcg gtacatcgat tggattgcag gcagcgattg ttccgttaac cgttggtgca       300
     gcaccgttta ttgcccgtat ggtcgagaac gctcttctgg agatcccaac cgggttaatt       360
     gaagcctccc gcgcaatggg tgccacgcca atgcagatcg tccgtaaagt gctgttaccg       420
     gaagcgttgc cgggtctggt gaatgcggca actattaccc tgattaccct ggtcggttat       480
     tccgcgatgg gtggtgcagt cggtgccggt ggtttaggtc agattggcta tcagtatggc       540
     tacatcggct acaacgcgac ggtgatgaat acggtactgg tattgctggt cattctggtt       600
     tatttaattc agttcgcagg cgaccgcatc gtccgggctg tcactcgcaa gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page