(data stored in ACNUC7421 zone)

EMBL: FM180568.MODA

FM180568.MODA        Location/Qualifiers
FT   CDS_pept        708671..709444
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="E2348C_0640"
FT                   /product="molybdate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08188"
FT                   /db_xref="GOA:B7ULN6"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULN6"
FT                   /protein_id="CAS08188.1"
FT                   /translation="MARKWLNLFTGAALSFAVAGNALADEGKITVFAAASLTNAMQDIA
FT                   TQYKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTASRQTL
FT                   LGNSLVVVAPKASEQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAW
FT                   DTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDPHKKVEYPV
FT                   AVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTTK"
     atggctcgta aatggttgaa cttgtttacc ggggcggcac tctctttcgc tgttgctggc        60
     aatgcactgg cagatgaagg gaaaatcacg gtgttcgccg ccgcatcact gactaacgca       120
     atgcaggaca ttgctacgca gtataaaaaa gagaaaggcg tggatgtggt ttcttctttc       180
     gcttcgtcat ctactttggc ccgtcagatt gaagcgggtg cgcctgcgga tctgtttatt       240
     tctgccgatc agaaatggat ggattatgcg gttgataaaa aagcgatcga tacggcttcg       300
     cgccagacac tgctcggcaa tagcctggtc gttgtagcac cgaaagccag cgagcagaaa       360
     gatttcacca tcgacagcaa aaccaactgg acttcgctgc tgaatggcgg tcgcctcgcg       420
     gttggtgatc cggaacatgt ccctgctggc atttatgcga aagaagcact gcaaaaactg       480
     ggcgcatggg atacgctctc cccgaaactg gctccggcgg aagatgttcg tggcgcgctg       540
     gcgttggtcg aacgcaatga agcgccgctg ggtattgttt acggttctga cgcagttgcc       600
     agcaaagggg taaaagtggt tgccaccttc ccggaagatc cacataaaaa agtggaatat       660
     ccggttgctg ttgtggaagg gcataacaat gcgacagtga aagcatttta tgattatctg       720
     aaggggccgc aggctgcgga aatctttaaa cgttacggat ttacaaccaa gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page