(data stored in ACNUC7421 zone)

EMBL: FM180568.MODB

FM180568.MODB        Location/Qualifiers
FT   CDS_pept        709444..710133
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="E2348C_0641"
FT                   /product="molybdate transport permease protein ModB;
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08189"
FT                   /db_xref="GOA:B7ULN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULN7"
FT                   /protein_id="CAS08189.1"
FT                   /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKA
FT                   LLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGERLYDWFGLSFAFSWRGAVLAAAVMSF
FT                   PLMVRAIRLALEGVDIKLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGE
FT                   FGATITFVSNIPGETRTIPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARI
FT                   SRERAGR"
     atgatactga ccgatccaga atggcaggca gttttattaa gcctgaaagt ttcttccctg        60
     gctgtgctgt ttagcctgcc gtttgggatc ttttttgcct ggttactggt acgttgcacg       120
     tttccgggca aagctctgct cgacagcgta ctgcatctac cgctggtgtt accgcccgtg       180
     gtcgtcggtt acctattatt agtttcgatg ggacggcgcg gatttatcgg tgaacgtctg       240
     tatgactggt ttggtctttc tttcgcgttt agctggcgtg gtgcggttct cgctgccgct       300
     gtcatgtctt ttccgctgat ggtgcgggcg attcgtctgg cgctggaagg tgttgatatc       360
     aaactggagc aggccgcaag aacactgggg gccgggcgct ggcgcgtttt ctttactatc       420
     acgttaccgc tgaccttacc gggaattatt gttggtacgg tgctggcatt cgctcgttcg       480
     ctcggtgaat ttggcgcaac catcaccttt gtttctaaca ttcctggtga aacgcgaacc       540
     attccttctg ccatgtatac cctgatccag acccctggcg gggaaagtgg cgcggcgaga       600
     ctgtgtatta tttctattgc gctggcgatg atctccctgt tgatttcaga atggctggcc       660
     agaatcagcc gtgagcgggc ggggcgctaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page