(data stored in ACNUC7421 zone)

EMBL: FM180568.MODC

FM180568.MODC        Location/Qualifiers
FT   CDS_pept        710136..711194
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="E2348C_0642"
FT                   /product="molybdate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08190"
FT                   /db_xref="GOA:B7ULN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULN8"
FT                   /protein_id="CAS08190.1"
FT                   /translation="MLELNFSQTLGNHCLTINETLPANGITAIFGVSGAGKTSLINAIS
FT                   GLTRPQKGRIVLNGRVLNDADKGICLTPEKRRVGYVFQDARLFPHYKVRGNLRYGMAKS
FT                   MVNQFDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPR
FT                   KRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVM
FT                   NPWLPKEQQSSILKVTVLEHHPHYAMTALALGDQHLWVNKLDEPLQAALRIRIQASDVS
FT                   LVLQPPQQTSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELAIKPGLW
FT                   LYAQIKSVSITA"
     atgctggaac tgaatttttc ccagacgttg ggcaaccatt gcctgacgat taatgaaacg        60
     ctgcccgcca atggcatcac cgctattttt ggtgtctctg gtgccggaaa aacctcgctg       120
     attaacgcca tcagtgggct gacacgtccg caaaaagggc ggattgtcct caatggtcgg       180
     gtactaaatg acgccgataa aggtatctgc ctgacgccag aaaagcgtcg cgtaggctat       240
     gtgtttcagg atgcgcggct gtttccgcat tataaagtgc gtggcaattt gcgctacggc       300
     atggcgaaaa gcatggtcaa tcagttcgat aagctggtgg cgcttttagg cattgaaccg       360
     ttgcttgatc gtttaccagg cagcctgtcc ggaggcgaaa aacagcgcgt ggcgattggt       420
     cgggctttgc tgacagcacc ggaattgctg ttgctggatg aaccgctggc gtcactggat       480
     attccgcgta aacgcgaact gttgccttat ctgcaacgtc tgacgcggga aatcaacatt       540
     ccgatgttgt atgtcagcca ttcgctggat gagatcctcc atctggcaga cagagtgatg       600
     gtactggaaa acggtcaggt gaaagccttt ggcgcgctgg aagaagtctg gggtagtagc       660
     gtgatgaatc cgtggctacc gaaagagcaa caaagtagca ttctgaaagt gacagtactt       720
     gagcatcatc cgcattacgc gatgaccgcg ctggcgctgg gcgatcagca tttgtgggtc       780
     aataagctgg acgaaccgct gcaagctgcg ctacgcatcc gcattcaggc ttccgatgtc       840
     tcgctggttt tacaaccgcc acagcaaacc agcattcgta acgtattgcg ggcaaaagtt       900
     gttaatagtt atgacgacaa cggccaggtg gaagtggagc tggaagtcgg cggtaaaacg       960
     ctgtgggcgc gtatcagccc gtgggccagg gatgaactgg cgatcaaacc tggcctgtgg      1020
     ctgtatgcgc aaattaaaag tgtgtcgata accgcctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page