(data stored in ACNUC7421 zone)

EMBL: FM180568.MOKC1

FM180568.MOKC1       Location/Qualifiers
FT   CDS_pept        complement(16852..17061)
FT                   /transl_table=11
FT                   /gene="mokC1"
FT                   /locus_tag="E2348C_0016"
FT                   /product="regulatory protein MokC for HokC 1"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07564"
FT                   /db_xref="GOA:B7UI61"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI61"
FT                   /protein_id="CAS07564.1"
FT                   /translation="MQNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRIGQTEVAVFTAYESE"
     atgcagaaca catgtagagt gcctcttact gaccgaaagg tcaaggagaa gagagcaatg        60
     aagcagcata aggcgatgat tgtcgccctg atcgtcatct gtatcaccgc cgtagtggcg       120
     gcgctggtaa cgagaaaaga cctctgtgag gttcacatcc gaattggcca gacggaggtt       180
     gctgttttca cggcttacga atccgagtaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page