(data stored in ACNUC7421 zone)

EMBL: FM180568.MOKC2

FM180568.MOKC2       Location/Qualifiers
FT   CDS_pept        540153..540404
FT                   /transl_table=11
FT                   /gene="mokC2"
FT                   /locus_tag="E2348C_0482"
FT                   /product="regulatory protein MokC for HokC 2"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08030"
FT                   /db_xref="GOA:B7UKM4"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKM4"
FT                   /protein_id="CAS08030.1"
FT                   /translation="MKPQEIFLSILGLPLQTQTIWMVVPSSHGGNINMLTKYALAAVIV
FT                   LCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK"
     atgaagcccc aggagatatt tctatcaatc ctggggctgc cactccaaac ccaaacaatt        60
     tggatggtag tcccttcttc gcatggaggc aatataaaca tgctgacgaa atatgccctt       120
     gcggcagtca tagtgctgtg tttgacggtg ctgggattta cgcttctggt cggagactcg       180
     ctgtgtgagt ttacggtgaa ggaacgtaat attgagttta aggctgttct cgcttacgaa       240
     ccgaagaagt ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page