(data stored in ACNUC7421 zone)

EMBL: FM180568.MRAZ

FM180568.MRAZ        Location/Qualifiers
FT   CDS_pept        95751..96209
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="E2348C_0086"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07634"
FT                   /db_xref="GOA:B7UID1"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UID1"
FT                   /protein_id="CAS07634.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSTNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
     atgttccggg gagcaacgtt agtcaatctc gacagcaaag ggcgcttatc agtgcctacc        60
     cgttatcggg aacagctgct tgagaacgct gccggtcaaa tggtttgcac cattgacatt       120
     catcacccgt gcctgctgct ttaccccctg cctgaatggg aaattatcga gcaaaaatta       180
     tcgcgtctgt cgagcacgaa cccggttgag cgccgtgtgc agcgcctact gttaggtcat       240
     gccagcgaat gtcagatgga tggcgcaggt cgattgttaa tcgcgccagt actgcggcaa       300
     catgccgggc tgacaaaaga agtgatgctg gttggacagt tcaacaagtt tgagctgtgg       360
     gatgaaacaa cctggcatca acaggtcaag gaagatatcg acgcagagca gttggctacc       420
     ggagacttat cggagcgact gcaggacttg tctctataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page