(data stored in ACNUC7421 zone)

EMBL: FM180568.NADA

FM180568.NADA        Location/Qualifiers
FT   CDS_pept        695669..696712
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="E2348C_0627"
FT                   /product="quinolinate synthase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08175"
FT                   /db_xref="GOA:B7ULM3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023513"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7ULM3"
FT                   /protein_id="CAS08175.1"
FT                   /translation="MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMV
FT                   AHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTI
FT                   LMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
FT                   DHLDSLGEKIIWAPDTHLGRYVQKQTGADILCWQGACIVHDEFKTQALTRLQEEYPDAA
FT                   ILVHPESPQAIVEMADAVGSTSQLIAAAKTLQHQRLIVATDRGIFYKMQQAVPDKELLE
FT                   APTAGEGATCRSCAHCPWMAMNGLQAIAEALEQEGSNHEVYVDERLRERALVPLNRMLD
FT                   FAATLRG"
     atgagcgtga tgtttgatcc agacacggcg atttatcctt tccccccgaa gccgacgccg        60
     ttaagcattg atgaaaaagc gtattaccgc gagaagataa aacgtctact aaaagaacgt       120
     aatgcggtga tggttgccca ctactatacc gatcccgaaa ttcaacaact ggcagaagaa       180
     accggtggct gtatttctga ttctctggaa atggcgcgct tcggtgcaaa gcatcccgct       240
     tctacgttgt tagtcgctgg ggtgagattt atgggagaaa ccgccaaaat tctcagtccg       300
     gaaaaaacaa ttctgatgcc gacacttcag gctgaatgtt cactggatct cggctgccct       360
     gttgaagaat ttaacgcatt ttgcgatgcc catcccgatc gtactgtcgt cgtctacgcc       420
     aacacttctg ctgcggtaaa agcgcgtgca gattgggtgg taacttcaag cattgccgtc       480
     gaacttattg atcatctgga tagtttgggt gaaaaaatca tctgggcacc tgacacacat       540
     ctggggcgtt acgtgcaaaa acagacgggc gcagacattt tatgctggca gggtgcctgc       600
     attgtgcatg atgagtttaa gactcaggcg ttaacccgct tgcaagaaga atacccggat       660
     gctgccatac tggtgcatcc agaatcaccg caagctattg tagagatggc ggatgcggtc       720
     ggttccacca gtcaactgat agctgctgcg aaaacattgc aacatcagcg gcttatcgtg       780
     gcaaccgatc ggggcatttt ctacaaaatg cagcaggcgg tgccagataa agagttactg       840
     gaagcaccaa ccgcggggga gggcgcaacc tgtcgcagct gcgcgcattg cccgtggatg       900
     gccatgaatg gccttcaggc catcgcagag gcattagaac aggaaggaag caatcacgag       960
     gtttatgttg atgaaaggct gcgagagagg gcgctggtgc cgctcaatcg tatgctggat      1020
     tttgcggcta cactacgtgg ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page