(data stored in ACNUC7421 zone)

EMBL: FM180568.NAGE

FM180568.NAGE        Location/Qualifiers
FT   CDS_pept        625421..627367
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="E2348C_0561"
FT                   /product="fused N-acetyl glucosamine specific PTS enzyme:
FT                   IIC, IIB, and IIA components"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08109"
FT                   /db_xref="GOA:B7UKV1"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV1"
FT                   /protein_id="CAS08109.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVVFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLNQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVVDSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLIIKAQGH
FT                   VVAGQTPLYEIKK"
     atgaatattt taggtttttt ccagcgactc ggtagggcgt tacagctccc tatcgcggtg        60
     ctgccggtgg cggcgctgtt gctgcgattc ggtcagccag atttacttaa cgttgcgttt       120
     attgcccagg cgggcggtgc gatttttgat aacctcgcat taatcttcgc catcggcgtg       180
     gcatccagct ggtcgaaaga cagcgcaggt gcggcggcac tggcgggtgc ggtaggttac       240
     tttgtgttaa ccaaagcgat ggtgaccatc aacccagaaa ttaacatggg tgtactggcg       300
     ggtatcatta ccggtctggt tggtggcgca gcctataacc gttggtccga tattaaactg       360
     ccggacttcc tgagcttctt cggcggcaaa cgctttgtgc cgatcgccac cggcttcttc       420
     tgtctggtgc tggcggccat ttttggttac gtctggccac cggtacagca cgctatccat       480
     gcaggcggcg agtggatcgt ttctgcgggc gcgctgggtt ccggtatctt tggtttcatc       540
     aaccgtctgc tgatcccaac cggtctgcat caggtgctga acaccatcgc ctggttccag       600
     attggtgaat tcaccaacgc ggcgggaacg gttttccacg gtgatatcaa ccgcttctat       660
     gccggtgacg gcaccgcggg gatgttcatg tccggcttct tcccgattat gatgttcggt       720
     ctgccgggtg cggcgctggc gatgtacttc gcagcaccga aagagcgtcg tccgatggtt       780
     ggcggtatgc tgctttctgt tgctgttact gcgttcctga ccggtgtgac tgagccgctg       840
     gaattcctgt tcatgttcct tgcgccgctg ctgtacctcc tgcacgcact gctgaccggt       900
     atcagcctgt ttgtggcaac gctgctgggt atccatgccg gcttctcttt ctctgcgggg       960
     gctatcgact acgcgttgat gtataacctg ccggccgcca gccagaacgt ctggatgctg      1020
     ctggtgatgg gtgttgtctt cttcgctatc tacttcgtgg tgttcagttt ggttatccgc      1080
     atgttcaacc tgaaaacgcc gggtcgtgaa gataaagaag acgagatcgt tactgaagag      1140
     gctaacagca atactgaaga aggtctcaat caactggcaa ccaactatat tgctgcggtt      1200
     ggcggtactg acaacctgaa agccattgac gcctgtatta ctcgtctgcg ccttaccgtg      1260
     gttgactcag ctcgcgtcaa cgatgcgatg tgtaaacgtc tgggtgcttc tggggtagtg      1320
     aaactgaaca aacagactat tcaggtgatt gttggcgcga aagcagaatc catcggcgat      1380
     gcgatgaaga aagtcgttgc ccgtggtccg gtagccgctg cgtcagctga agcaactccg      1440
     gcaactgccg cgcctgtagc aaaaccgcag gctgtaccaa acgcggtatc tatcgcggag      1500
     ctggtatcgc cgattaccgg ggatgttgtg gcactggatc aggttcctga cgaggcattc      1560
     gccagcaaag cggtgggtga cggtgtggcg gtgaaaccga cggataaaat cgtcgtatca      1620
     ccagccgcag ggacaatcgt gaaaatcttc aacaccaacc acgcgttctg cctggaaacc      1680
     gaaaaaggcg cggagatcgt cgtccatatg ggtatcgaca ctgtagcgct ggaaggtaaa      1740
     ggctttaaac gtctggtgga agagggcgcg caggtaagcg cagggcaacc gattctggaa      1800
     atggatctgg attacctgaa cgctaacgcc cgttcgatga ttagcccggt ggtttgcagc      1860
     aatatcgacg atttcagtgg cttgatcatt aaagctcagg gccatgttgt ggcgggtcaa      1920
     acaccgctgt atgaaatcaa aaagtaa                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page