(data stored in ACNUC7421 zone)

EMBL: FM180568.NFRA

FM180568.NFRA        Location/Qualifiers
FT   CDS_pept        complement(520440..523412)
FT                   /transl_table=11
FT                   /gene="nfrA"
FT                   /locus_tag="E2348C_0468"
FT                   /product="bacteriophage N4 receptor, outer membrane subunit
FT                   NfrA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL0"
FT                   /protein_id="CAS08016.1"
FT                   /translation="MKENNLNRVIGWSGLLLTSLLSTSALADNIGTSAEELGLSDYRHF
FT                   VIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLL
FT                   EDQLKRHPGDDRLEHSLAAIPVEVKSVTTVEELLAQQKACDAAPTLRCRSEVGQNALRL
FT                   AQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAER
FT                   RQWFDVLLAAQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENTPLFT
FT                   TDAQEKSWLYLLSKYSGNPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLA
FT                   TLPANEMLEERYSVSVATRNKAEALRLARLLYQQEPANLTRLDQLTWQLMQNEQSREAA
FT                   DLLLQRYPFQGDARVSQTLMARLASLLESHPYLATPAKVAILSKPLPLAEQRQWQSQLP
FT                   GIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPDAWQHRA
FT                   VAYQAYQVEDYATALAAWQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEQRGL
FT                   GNNALYWWLHAQRYIPGQPELALNDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDL
FT                   RAALELEPNNSNTQAALGYALWDSGDIAQSREMLEQAHKGLPDDPALIRQLAYVNQRLD
FT                   DMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRS
FT                   GAMSTANNNVGGAAPGKSYRSYRQLEAEYRIGRNMLLEGDLLSVYSRVFADTGENGVMM
FT                   PVKNPMSGTGLRWKPLRDQIFFLAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWH
FT                   PNGSGWFAQNLYLDAAQYVRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKG
FT                   TQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVH
FT                   W"
     atgaaggaga ataaccttaa tcgcgtcatc ggatggtctg gtttactgct gacgtcttta        60
     ttgagtacca gcgcactcgc agacaatatc ggcaccagcg cagaagagct ggggctgagc       120
     gattatcgcc attttgttat ttatccccgt ctcgataagg cgctgaaggc acagaaaaat       180
     aacgacgaag caaccgccat ccgcgaattt gaatatatac accagcaggt gccggataat       240
     attccgctga ctttatacct tgcggaagcc tatcgccatt ttggtcatga tgaccgggcg       300
     cggctgttgc ttgaggatca actgaaacgt caccctggag atgaccggct tgagcacagt       360
     ctggcggcta ttccagttga agtgaaaagc gttacgactg ttgaagaact gcttgcccag       420
     caaaaagcgt gcgatgctgc gccgaccctg cgttgtcgca gtgaagtcgg gcagaatgct       480
     ctgcggctgg cacaattacc tgtcgccaga gcgcaactaa acgatgcgac gtttgctgca       540
     tcgccggaag gaaaaacgtt gcgaaccgat ctgctgcaac gggcaatcta cctgaaacaa       600
     tggtcccagg cagatacgct atataatgaa gcacgccagc agaacacatt aagcgcggca       660
     gaacgccgtc agtggtttga cgtgcttctt gccgcgcagc tggatgatcg gatcctggcg       720
     ctgcaatcac aggggatctt caccgatcct cagtcatata ttacttacgc gaccgcgctg       780
     gcttatcgtg gcgaaaaagc acgcctccag cattatctca ttgaaaatac gccgctattt       840
     accacggacg cacaagagaa aagttggctc tatctgttat ctaaatacag cggcaacccc       900
     gttcaggcgt tagcgaatta tacggtacag tttgccgaca accgccagta tgttgttggc       960
     gcgacgctac cggtgctgtt aaaagaaggt cagtacgacg cagcgcaaaa actgctcgcc      1020
     accctccccg ccaatgaaat gcttgaggag cgttattccg ttagcgtggc gacccgtaac      1080
     aaggctgaag ctctgcgtct ggcacgattg ctgtatcagc aagaaccggc aaatcttacc      1140
     cgcctggatc aactgacctg gcaactgatg cagaacgagc agtcacgcga agctgccgat      1200
     ttattgctgc aacgctatcc tttccagggc gatgcgcgtg tcagccagac tttaatggcg      1260
     cgactggcgt ctctgctgga aagtcatcct tacctggcaa ctccggcgaa ggtggcgatt      1320
     ttatcgaaac ccttaccgct ggcggagcaa cgtcagtggc aaagtcagtt gccgggtatt      1380
     gcagataatt gcccggcaat agttcgcttg ctgggcgata tgtcgccttc ctacgatgcc      1440
     gccgcctgga accgtctggc aaagtgttat cgggacacgc tacccggtgt ggcgttgtat      1500
     gcatggcttc aggccgaaca acgacaaccg gacgcctggc aacatcgtgc ggtagcctat      1560
     caggcgtatc aggttgagga ctacgccacc gcactggcgg cctggcagaa aatcagtctt      1620
     cacgacatga gcaatgagga tctgcttgct gctgccaata ccgcccaggc ggcaggaaat      1680
     ggtgcggctc gcgatcgctg gcttcagcag gcagaacaac gtgggctggg aaacaatgcc      1740
     ctctactggt ggctgcatgc gcaacgttac attcctggtc agccggaact cgcactgaac      1800
     gatctcacgc gctcaatcaa tattgcgcct tctgccaacg cttacgttgc gcgggcgaca      1860
     atttatcgcc aacgtcataa tgtcccggcg gcggtgagtg atttgcgcgc cgcgctggaa      1920
     ctggaaccga ataatagcaa cacccaggca gcgctcggtt acgccttgtg ggatagcggt      1980
     gatatcgcac agtcgcggga aatgctcgaa caggcgcata aagggctacc ggacgatccg      2040
     gcacttatcc gacaactggc ctacgtgaac cagcgtctgg atgacatgcc tgcgacgcag      2100
     cactacgccc ggctggtgat tgatgacatt gataatcagg cgctgataac cccactgacc      2160
     ccagagcaaa atcagcaacg cttcaatttc cgccgtctgc atgaggaggt cggtcgccgc      2220
     tggacgttca gtttcgattc ttctatcggc ttgcgttccg gcgcaatgag taccgctaac      2280
     aataatgtcg gcggcgcagc gccagggaaa agctatcgta gctacaggca actggaagcc      2340
     gagtaccgca tcggacgcaa tatgctgctg gaaggcgacc tgctctcagt ttatagccgc      2400
     gtctttgccg ataccggaga aaacggggtg atgatgccgg tgaaaaatcc gatgtccggc      2460
     accggtctgc gctggaagcc gctgcgcgat cagatctttt tcctcgccgt cgaacagcag      2520
     ttgccgctga acgggcaaaa tggcgcatcc gataccatgc tgcgcgccag cgcctcattc      2580
     tttaatggcg gcaaatacag cgacgaatgg cacccgaacg gttcaggctg gtttgcccaa      2640
     aacctgtacc tcgatgcggc gcaatatgtc cgccaggata ttcaggcgtg gacggcagat      2700
     tatcgcgtaa gctggcatca gaaggtggcg aacggacaga ctattgagcc ttacgctcac      2760
     gttcaggaca acggttatcg tgataaaggc actcagggcg cgcagcttgg cggtgtcggg      2820
     gtccgctgga atatctggac cggcgagacg cactacgacg cctggccgca caaagtcagt      2880
     ctcggcgtcg aatatcaaca tacctttaag gcgattaatc aacgtaacgg agagcgcaac      2940
     aacgcgtttc tcaccattgg agtgcactgg taa                                   2973
//

If you have problems or comments...

PBIL Back to PBIL home page