(data stored in ACNUC7421 zone)

EMBL: FM180568.NFRB

FM180568.NFRB        Location/Qualifiers
FT   CDS_pept        complement(523399..525636)
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="E2348C_0469"
FT                   /product="bacteriophage N4 receptor, inner membrane subunit
FT                   NfrB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08017"
FT                   /db_xref="GOA:B7UKL1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL1"
FT                   /protein_id="CAS08017.1"
FT                   /translation="MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRI
FT                   KRKLSVYRRYPRMSYRELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFV
FT                   GTYPNDPDTQRDVDEVCARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFA
FT                   GFILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKD
FT                   VPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTE
FT                   IFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFK
FT                   THKWTSSLTLNYFLWRDRKGAISNFVSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSG
FT                   SAWLMTLLWLNFGLMINRIVQRVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQ
FT                   VLQHGDPRRVAWDKTTHDFPSVTGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLR
FT                   QGGSMLMQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRL
FT                   DNDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYAHRRGHDPRAML
FT                   YNAVQHQWLTEQQAGEIWRQYVPHQFLFAEILTTLGHINRSAINVLLLRHERSSLPLGK
FT                   FLVTEGVISQETLDRVLTIQRELQVSMQSLLLKAGLNTEQVAQLESENEGE"
     gtggactggc ttcttgatgt ttttgctacc tggctctacg gcttaaaagt aatcgcgata        60
     acgttagcgg tcattatgtt catcagcggg ctggacgatt tttttattga tgtcgtctac       120
     tgggtacgcc gcattaaacg caagttgagt gtttatcgcc gctacccgcg aatgagttac       180
     cgcgaactgt ataaaccaga tgaaaaaccg ttagcgatta tggttccggc gtggaatgaa       240
     acgggcgtca tcggcaatat ggccgagctg gcggcgacca cgctcgacta cgaaaactat       300
     catatctttg ttggcaccta ccccaacgac cccgatactc agcgtgatgt tgacgaagtg       360
     tgcgctcgct tcccgaacgt gcataaggta gtctgcgcgc gtcctggccc caccagcaaa       420
     gccgactgtc tgaacaacgt gctggacgcc atcacccaat ttgaacgtag cgccaatttc       480
     gcttttgctg gttttattct gcatgacgcc gaagatgtga tttcaccgat ggaattgcgt       540
     ctgttcaact atctggtcga gcgtaaagat ctgattcaga tcccagtgta tccgttcgaa       600
     cgcgaatgga cgcacttcac cagcatgacc tacattgatg agttttcaga actgcatggc       660
     aaagatgttc cggtgcgtga agccctcgcc ggacaggtgc ccagcgcagg cgtcggtacc       720
     tgtttcagcc gccgcgccgt gaccgcactg ttagctgacg gtgacggtat tgctttcgac       780
     gtgcagagtc tgactgaaga ttacgacatt ggcttccgcc tgaaagagaa aggtatgacg       840
     gaaatttttg tccgttttcc ggtggtggac gaagccaaag aacgcgagca gcgtaaattt       900
     ttacagcatg cgcggacgtc aaacatgatc tgcgtgcgcg aatatttccc cgataccttt       960
     tcgactgcgg ttcggcaaaa atctcgctgg atcatcggca ttgttttcca gggctttaaa      1020
     acccacaaat ggacctccag cctgacgctg aactactttc tctggcgcga ccgcaaaggg      1080
     gcaatcagta actttgtcag cttcctcgcg atgctggtga tgatccagct tttgctgttg      1140
     ctggcgtatg aaagtttgtg gcccgatgcc tggcatttcc tttctatttt cagcggcagc      1200
     gcatggttaa tgactctgct gtggctaaac tttggcttga tgattaaccg catcgtgcag      1260
     cgggtgattt tcgttactgg ctactacggc ctgacgcagg ggctgctatc tgtcctgcgt      1320
     cttttctggg gcaacctgat taacttcatg gccaactggc gcgcgttaaa acaggtactt      1380
     caacacggcg atccacgtcg tgtcgcgtgg gataaaacaa cgcatgactt ccccagcgtg      1440
     actggcgata cccgctcgtt gcgtccgtta ggccaaatcc tgctggaaaa tcaggtcatc      1500
     actgaagaac aactcgatac agcactgcgt aatcgcgtcg aaggtctacg ccagggcggt      1560
     tcaatgctga tgcaggggct gattagcgcc gagcaactgg cacaggcgct ggcagagcaa      1620
     aacggcgtgg cgtgggaatc catcgatgcc tggcagatcc cttcctcgct gattgccgaa      1680
     atgccggcct ccgtggcgtt gcattatgcg gtactgccgc tgcgtctgga caatgatgag      1740
     ttaattgtcg gcagtgaaga tggtattgac ccggtttcgc tggcggccct gacgcgtaaa      1800
     gtcggacgca aagtgcgtta cgtcattgtt ctgcggggac aaattgtcac cggattacgc      1860
     cactggtatg cacaccgacg cggtcacgat ccgcgggcaa tgttgtacaa tgcagttcag      1920
     catcagtggc tcacggaaca gcaggccggt gaaatctggc ggcaatatgt gccgcatcag      1980
     ttcctgttcg cagaaatact gaccacgctc ggtcatatta atcgttcagc aattaacgtg      2040
     ttgttattgc gccatgaacg cagttctctg ccgctcggca agtttttggt caccgaaggt      2100
     gttatcagcc aggaaacgtt ggatcgcgtc ctgacaattc aacgcgaatt acaagtttcg      2160
     atgcaatcac tattactcaa agcaggttta aacacagaac aggttgcaca actggagtcc      2220
     gaaaatgaag gagaataa                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page