(data stored in ACNUC7421 zone)

EMBL: FM180568.NRDR

FM180568.NRDR        Location/Qualifiers
FT   CDS_pept        392031..392480
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="E2348C_0348"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07896"
FT                   /db_xref="GOA:B7UJN6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJN6"
FT                   /protein_id="CAS07896.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
     atgcattgcc cattctgttt cgccgtggac actaaggtaa ttgactctcg tctcgtgggc        60
     gagggttcat ccgtacgccg ccgtcggcag tgtctggtgt gtaatgaacg tttcaccacc       120
     tttgaagtgg cggagctggt tatgccgcgt gttgtaaaaa gcaacgacgt gcgtgaaccg       180
     tttaatgaag agaaattacg tagcggaatg ctgcgggcgc tggaaaaacg tccggtgagt       240
     tccgatgacg tcgaaatggc aatcaatcat ataaaatcgc agctgcgcgc caccggtgag       300
     cgcgaagtgc cgagcaagat gattggcaat ctggtgatgg agcaattgaa aaagctcgat       360
     aaagtcgcct atatccgttt tgcctctgtc taccgcagtt tcgaagatat caaagaattt       420
     ggcgaagaga tcgcgcgcct ggaggactaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page