(data stored in ACNUC7421 zone)

EMBL: FM180568.PE153

FM180568.PE153       Location/Qualifiers
FT   CDS_pept        173313..173879
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0153"
FT                   /product="predicted fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07701"
FT                   /db_xref="GOA:B7UIJ4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ4"
FT                   /protein_id="CAS07701.1"
FT                   /translation="MNKKLLSLLVSGSFIAAVSTSVFAADTGVVNFNGKIVADTCEINV
FT                   NDSNSTTGIVTFADTYPADYSGDGTVGTSKDFKIELIKCDPLVTKLNLTFSGTTTDTGF
FT                   LRLENSETATGSATNVGITVTNKNGGTNNVKFDGSVPDVSTDVDNAGDSTPTIFNYTAN
FT                   VIQVGNNAPTAGKYASSATFEVFYR"
     atgaataaaa aattactttc tcttttagtg tcaggaagtt tcatagcagc agtaagtaca        60
     agtgtatttg ctgcagatac tggagtggtt aactttaacg gtaaaattgt tgccgatact       120
     tgcgaaatta atgtaaacga ttctaatagt acaacaggaa ttgtcacttt tgcagatact       180
     tacccagcgg attattccgg agatggtaca gtcggtactt caaaagattt taagattgag       240
     ttaataaaat gcgatccgtt ggtgacaaaa ctaaacctga ccttttccgg aacaacaacg       300
     gatacaggtt tccttcgtct ggaaaatagc gaaacggcta ccggcagcgc aacaaatgtt       360
     ggtattacgg tgacgaataa aaatggcgga actaacaatg tgaaatttga tggttcagtt       420
     cctgatgtat ccaccgatgt cgataatgct ggagacagca ccccaacgat atttaattac       480
     acggccaatg ttattcaggt tggtaacaac gcaccaactg cgggtaaata tgcctcatct       540
     gcgactttcg aagtgtttta tcgttaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page