(data stored in ACNUC7421 zone)

EMBL: FM180568.PE155

FM180568.PE155       Location/Qualifiers
FT   CDS_pept        174685..177162
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0155"
FT                   /product="predicted fimbrial outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07703"
FT                   /db_xref="GOA:B7UIJ5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ5"
FT                   /protein_id="CAS07703.1"
FT                   /translation="MSLPMHRTFVLTGIIFALSAVYSLSYARDEFNLRILELDSPLENT
FT                   QVLADFINNNNLTPGVYLTSVMWGQDSLDKRNITFVLSSDKKSLIPRFTKADLREFGLK
FT                   VDVIPALKVMNDDTEVGDIAQIIDGARYDFQLDSQTLWLRIPQIYQNAIAAGSIAPKYW
FT                   NDGESAAWLSYYASGSRQNSDGDNLSSNWLNLNSGINLGAWRLRNNTVYNESNWESIST
FT                   SLQRDIKALRSQMEIGQTFTNGDLFDSVQMTGIKLETDTSMLPDSEQGFAPVVRVIANS
FT                   DAQVVIKQNGYVIYQTWVSAGPFEIKDLSQVTAGSDLEVTIKETNGQEHSFIQASSTVP
FT                   ILQREGALKYSLAAGKYRDSDNNAETPVFGVATAIYGLPYGITIYGGILGASMYHSGVT
FT                   GIGADLGRLGSVSVDITAAKTKFDDGRDDATGLSWRAQYAKDFPDTDTTVTLASYRYST
FT                   SQFYTFQEALDQRDTPDDKGIYSYRQTNNRRNRLQINLSQNIGRWGSVYLNGYQQDYWG
FT                   MHGAERSIGMGYSTTWNNINWSVNYTLTKTPGMTGEQQFSLTLNIPLSRWLPDSWAMYN
FT                   VNRSDKSNTSHQLGIGGTALQDNNLSYNLQQSYTDNNVGYGASMNGRYRSSVGEFGLGY
FT                   SYDKNSRQWNYSAQGAVVAHAHGVTLGQSVQDSFAIVHINEGANVKVQNAQGVYTDFWG
FT                   NAIVPNMTNYRHNAITVNTQGHDSLDISDATQDVIPSKGAVVGVDFDARSGMRALLTLV
FT                   HNKERVPFGALLTLGNSTAIVGEDGEVYITGVQESMTFTVQWGKEINQQCTGVITEPEK
FT                   YTTGIYKATMDCR"
     atgtcgctac caatgcatcg cacatttgtt ttaactggaa taatatttgc gttatcggca        60
     gtgtattcat tgagctatgc acgagatgaa tttaaccttc gtatccttga gttggatagc       120
     ccacttgaaa atacacaagt actggcagat ttcattaata ataataactt aactccaggt       180
     gtatatctta cctctgtcat gtgggggcaa gattctcttg ataagagaaa tattacattt       240
     gttctttctt cggataaaaa aagtctcatt cctcgtttta caaaagcgga tctccgtgaa       300
     ttcggtctta aagttgatgt gattcctgcg ttaaaagtaa tgaatgatga tactgaggtt       360
     ggagatattg cacagattat tgatggcgca cgttatgatt tccagttaga cagtcaaacg       420
     ctgtggctgc ggatccctca aatctatcag aatgcaatag ccgcaggtag tattgcaccg       480
     aaatactgga atgatggtga gagtgcggct tggttaagtt attatgccag tggttcccgg       540
     caaaatagtg atggtgataa cctgagttca aattggttga atttaaattc aggtattaat       600
     ttaggcgcat ggcggctacg aaataataca gtttacaatg aatccaattg ggaatcgatt       660
     agcaccagtt tgcaacgcga tatcaaagca ttaagaagtc agatggaaat tgggcagact       720
     ttcacaaatg gtgatctttt tgacagtgtg caaatgacag gtattaaact tgaaactgat       780
     accagtatgt tacctgacag cgaacaaggc tttgcaccag tagttcgtgt tatcgctaac       840
     agcgatgcgc aagttgtgat taaacaaaat ggctatgtca tttaccaaac atgggtatca       900
     gcagggccat ttgaaattaa agacttaagt caggtaacgg caggatctga tctggaagtc       960
     accatcaaag aaacaaatgg gcaagaacac agttttattc aggccagttc aacggttcca      1020
     attctacagc gagaaggcgc attaaaatat agtcttgcag ctggaaaata tcgtgacagt      1080
     gataataatg ctgagacacc tgtttttggt gttgcaaccg cgatatatgg cttgccctat      1140
     ggaataacga tttatggcgg catacttggt gcctcaatgt atcattctgg tgtgacaggg      1200
     attggcgctg atttaggccg tctggggtcg gtatctgttg atatcaccgc agcaaaaacg      1260
     aagtttgatg atgggcgtga tgatgcaaca gggctgtcat ggcgtgcaca gtatgcgaaa      1320
     gattttccag acactgatac gacagtaact ctggcaagtt atcgttattc cacatcacaa      1380
     ttttacactt tccaggaagc acttgatcaa cgtgatacac ctgatgacaa gggtatttac      1440
     agttatcggc agacaaataa tcggcgtaat cgtttacaaa ttaatctttc acaaaatatt      1500
     ggtcgttggg gctcggtcta ccttaatggt tatcaacagg attattgggg aatgcatggg      1560
     gccgaacgca gtataggaat ggggtacagt acgacctgga ataatattaa ctggtctgtt      1620
     aattacacac taacgaaaac gccaggaatg actggcgagc agcaattttc attaacactc      1680
     aatattcctc tctctcgctg gctgccagat tcatgggcga tgtataacgt aaaccgttcc      1740
     gataaaagta atacatcaca tcaattggga attggcggta ctgctctgca agataacaac      1800
     ctgagttata atttacagca aagttatact gataataatg tgggttatgg tgccagcatg      1860
     aatggacgtt atcgtagctc agtgggtgaa ttcggtctgg gatatagcta tgataaaaat      1920
     agtcgtcagt ggaattacag tgcgcaaggt gcggttgttg ctcatgctca tggagtaaca      1980
     ttggggcaat cagtgcagga ttcattcgcg atcgtgcata ttaatgaggg tgccaatgta      2040
     aaagtacaaa atgcgcaagg cgtttatact gatttttggg gaaacgcgat tgttcccaat      2100
     atgacgaatt atcgacataa cgctattact gtgaatactc aggggcacga tagtcttgat      2160
     atttctgatg ccacacaaga tgttattcct tcgaaaggtg ctgttgtcgg tgtcgatttt      2220
     gatgcacgta gcggaatgcg agccttattg acattagtcc ataataaaga acgcgtcccc      2280
     tttggggcat tgctgacatt agggaatagc acagcgattg ttggtgaaga tggagaggtt      2340
     tatattactg gtgtgcaaga atcaatgaca tttacggtac agtggggaaa agagattaac      2400
     cagcaatgta caggagttat cactgaacca gaaaaataca ccacgggtat ctataaagcc      2460
     acaatggatt gtcgataa                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page