(data stored in ACNUC7421 zone)

EMBL: FM180568.PE156

FM180568.PE156       Location/Qualifiers
FT   CDS_pept        177184..178194
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0156"
FT                   /product="predicted fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07704"
FT                   /db_xref="GOA:B7UIJ6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ6"
FT                   /protein_id="CAS07704.1"
FT                   /translation="MKPGFASYIRALLTIIFLSWGVIPAVFASCNISGNGGNPATVQFS
FT                   APALVVNSDAVPGTIIATVNANSPSISVSCTANGEIWQGYTVLTNGDKRTDNPLTDVFQ
FT                   TNVPGIGFRAAWANNTSAQLTAGSLMTPWHKGSSTVIKGYVYPITIHAAIQFIVTGPVG
FT                   NGTIDTSKLIADWKYDNRVIGELRFSSVPVNIQPGTCDLIEKNITVPLNDIGTDDFDVN
FT                   NVSPVVSDDRFKIQIEKCSQDVKVDYRFTSSGSTGITGNSILNIESGSGMAEGVGLQIL
FT                   DSSNNVMVFDSDYTAIQKTTLNQNITIPLKARYIKTGSVKSGRVNSVATFEVYYR"
     atgaagccag gatttgcctc ttatatacga gcattattga ccataatatt tcttagctgg        60
     ggcgtcattc ctgcggtttt cgccagttgc aatatttctg gaaatggagg aaatccggca       120
     acagtacaat tctccgcgcc tgcgttggtt gttaatagcg atgccgttcc tggaacgatt       180
     attgcgacag taaatgcgaa cagtccttca atttcagttt cctgtacggc aaatggtgag       240
     atctggcaag gatataccgt attgacaaac ggtgataagc gtactgataa cccacttaca       300
     gatgtgtttc agactaatgt gccaggaatc ggttttcgtg ccgcgtgggc gaataacacc       360
     agtgcgcaac tcaccgccgg atctttaatg acgccctggc ataaaggctc gtcaacagtg       420
     attaaaggat atgtttatcc gattacaata catgcagcta ttcagtttat tgtcacagga       480
     cctgtcggta atgggaccat tgataccagc aaactgattg ctgactggaa gtatgacaat       540
     cgtgttattg gagagcttcg ttttagttcc gttccggtca atattcaacc gggcacatgc       600
     gaccttatag aaaaaaatat taccgttccg ctcaacgata ttggcacaga tgattttgat       660
     gttaacaatg tgtcacctgt agtttctgac gataggttta aaattcagat tgaaaaatgc       720
     tcgcaggatg taaaagttga ttaccgcttt acttcatcag gctctacggg gataacgggt       780
     aatagtattc ttaatattga gtccggttcc ggaatggcag aaggtgttgg tctgcagatc       840
     ctggacagta gcaacaatgt aatggtattt gattcagact atacagccat tcaaaaaacg       900
     acgttgaatc aaaatattac tattccttta aaagcacgtt acatcaaaac gggtagcgtt       960
     aaaagtggtc gcgttaattc tgtcgctacc ttcgaagtgt attaccgata a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page