(data stored in ACNUC7421 zone)

EMBL: FM180568.PE18

FM180568.PE18        Location/Qualifiers
FT   CDS_pept        17619..18380
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0018"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07566"
FT                   /db_xref="GOA:B7UI63"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI63"
FT                   /protein_id="CAS07566.1"
FT                   /translation="MSAKRRLLIACTLITAIYHFPAYSSLEYKGTFGSINAGYADWNSG
FT                   FVNTHRGEVWKVTADFGVNFKEAEFYSFYESNVLNHAVAGRNHTVSAMTHVRLFDSDMT
FT                   FFGKIYGQWDNSWGDDLDMFYGFGYLGWNGEWGFFKPYIGLHNQSGDYVSAKYGQTNGW
FT                   NGYVVGWTAVLPFTLFDEKFVLSNWNEIELDRNDAYTEQQFGRNGLNGGLTIAWKFYPR
FT                   WKASVTWRYFDNKLGYDGFGDQMIYMLGYDF"
     atgtctgcca aaagacgact tcttattgcg tgtaccctga taacagctat ctatcatttt        60
     cctgcatatt cttcattaga atataaagga acctttggtt caataaatgc gggttatgca       120
     gactggaata gtggatttgt aaacactcac cgtggtgaag tatggaaagt gactgcggat       180
     tttggggtaa attttaaaga agcagaattt tactcatttt atgaaagtaa tgtactcaat       240
     catgctgtag cagggagaaa tcatacggtt tcagcaatga cgcatgtcag actctttgac       300
     tctgatatga cattctttgg caaaatttat ggccaatggg ataactcatg gggtgacgat       360
     ctggacatgt tttatggatt cggttacctc ggctggaacg gcgagtgggg cttttttaaa       420
     ccgtatattg gattgcataa tcaatctggt gactacgtat cagctaaata tggtcaaacg       480
     aatggttgga atggttatgt tgttggctgg acagcagtat taccatttac gttatttgac       540
     gaaaaatttg ttttatctaa ctggaatgaa atagaactgg acaggaacga tgcttacacg       600
     gagcagcaat ttggccggaa cgggttaaat ggcggtttaa ctattgcctg gaagttctat       660
     cctcgctgga aagccagtgt gacgtggcgt tatttcgata ataagctggg ctacgatggc       720
     tttggcgatc aaatgattta tatgcttggt tatgatttct aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page