(data stored in ACNUC7421 zone)

EMBL: FM180568.PE20

FM180568.PE20        Location/Qualifiers
FT   CDS_pept        20023..21282
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0020"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07568"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI65"
FT                   /protein_id="CAS07568.1"
FT                   /translation="MFTNVNVDCCKTPGCKNLGLLNSQDYVAQGKNILCRECGYLFPVI
FT                   SEQSLNIYRNIVNHSWRGLICQCSTCGGTSLKKYGYSAQGQRRMYCHHCEKTFITLEHV
FT                   ITTPRGAQLALMIEQGEALADIRKSLLLNSTGLSRELLKLAREANYKESRQCFPASDIT
FT                   LSTRAFRVKYNGSNNSLYALVTAEEQSGRVVAISTNYSSSAVEQHYQYTSNYEERMSPG
FT                   TLAHHVQRKELLTMRRDTLFDIDYGPAVLHQNDPGMLVKPVLPAYRHFELVRILTDEHS
FT                   NNVQHYLDHECFILGGCLMANLQHIHQGRCHISFVKERGVAPATIDFPPRLFLSGGVRN
FT                   NVWRAFSNRNYSMAVCNLTGSKKVREMRHATLNSATRFIHFVENHPFLISLNRMSPANV
FT                   VSTLDILKHLWNKKLEHGTI"
     atgtttacca acgtaaatgt tgattgttgc aaaacaccag gatgtaaaaa cctggggttg        60
     ctgaatagcc aggattatgt cgcacagggt aaaaatattt tatgccgtga atgtggttac       120
     ttgtttccag tgatatctga acagtcgctt aatatttatc gtaatattgt gaatcactcc       180
     tggagaggtt tgatttgcca atgttcaact tgcggaggca cgtccctcaa aaaatatgga       240
     tattctgcac aaggccagag aagaatgtat tgccatcatt gtgagaaaac atttatcact       300
     ctggaacatg taattaccac accacgagga gcccagttag cattgatgat tgagcaaggg       360
     gaggcacttg cggatatcag aaagtcatta cttcttaaca gcactggact tagccgtgaa       420
     ctgttaaaat tagcgcgtga agcaaactat aaagaaagtc gacagtgttt cccagcttct       480
     gatattaccc tgagtacccg cgcttttcgc gtcaagtata atggtagcaa taactctctt       540
     tatgctcttg ttaccgcaga agaacaaagc ggcagggtgg ttgccatctc aaccaattac       600
     tcctcatctg ccgtagagca acattatcaa tacacatcga actatgaaga gcgtatgtct       660
     ccagggacgc tggcacatca tgtccagcgc aaagagttac ttactatgcg gcgggatacc       720
     ttgtttgata ttgattacgg cccggcagtt ttacatcaaa acgatccggg aatgttggta       780
     aaaccggttc ttccggcata tcgccatttt gaactggtca gaatactgac cgatgagcat       840
     tccaacaacg ttcagcatta ccttgatcac gaatgcttta tattgggcgg ctgcctgatg       900
     gctaatttgc agcatattca tcaaggtcgc tgccatattt cctttgtcaa agagcgcggt       960
     gtggcacccg ccaccattga ttttccaccg cgattattcc ttagtggtgg ggtacgaaat      1020
     aatgtctggc gtgcattttc taaccgcaat tattcaatgg ctgtatgcaa tctcactggc      1080
     agtaagaaag tccgcgagat gcggcatgca acattgaaca gtgcgacgcg ttttatccac      1140
     tttgtggaga accatccttt ccttatatca ttgaaccgaa tgtctcctgc gaatgtcgtt      1200
     tctacattag atatcctcaa acatctgtgg aataaaaaac tagagcatgg aacaatttaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page