(data stored in ACNUC7421 zone)

EMBL: FM180568.PE223

FM180568.PE223       Location/Qualifiers
FT   CDS_pept        complement(254790..255146)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0223"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07771"
FT                   /db_xref="GOA:B7UJB9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJB9"
FT                   /protein_id="CAS07771.1"
FT                   /translation="MNKASNIITIKGQPAAVTFEADINAFRGKFLNVNGYCDFVATSIE
FT                   ALYREGESALDEWMADCEEDGIAPFREEEEQKRLTLRVPHHIDSRLTIVARQHSISKNQ
FT                   LIIDVLEREFSAQM"
     atgaataaag catcgaacat tatcacaatt aaaggtcaac cagccgcagt gacatttgaa        60
     gccgatatca acgcatttcg cggcaagttc ctcaatgtaa acggttattg tgactttgta       120
     gccacaagta ttgaggcatt atatcgtgaa ggcgaaagcg cgctggatga gtggatggcg       180
     gattgtgaag aggacggtat tgcccctttt cgtgaagaag aagagcaaaa acgcctgacg       240
     cttcgtgttc ctcatcacat tgattcgcgg ctgaccatcg tcgccagaca acattccatt       300
     tcaaaaaacc agctcattat tgatgtctta gaacgtgagt tttcagccca gatgtaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page