(data stored in ACNUC7421 zone)

EMBL: FM180568.PE228

FM180568.PE228       Location/Qualifiers
FT   CDS_pept        259757..260896
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0228"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07776"
FT                   /db_xref="GOA:B7UJC3"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC3"
FT                   /protein_id="CAS07776.1"
FT                   /translation="MGKYIRPLSDAVLTIASDDLWIESSAIQQLHTTANLPDMQRVVGM
FT                   PDLHPGRGYPIGAAFFSVGRFYPALVGNDIGCGMALWQTDIFARKYNADKFEKRLSDLD
FT                   DVAEESWLEENLPSAFAQHPWRSSLGSIGGGNHFAELQQIDQIIDAELFALAGLDAQHL
FT                   QLLVHSGSRGLGQSILQRHIASFSHHGLPEGSDDALSYIAEHDDALAFARINRQLIALR
FT                   IMQQVKANGNSVLDVAHNFVSACRIGDQQGWLHRKGATPDDNGLVIIPGSRGDYSWLVK
FT                   PVANEKTLHSLAHGAGRKWGRTECKGRLAAKYTATQLSRTELGSRVICRDKQLIFEEAP
FT                   QAYKSAESVVQCLVLAGLIIPVARLRPVLTLKNSGGKKG"
     atgggcaaat atattcgtcc cttatctgat gcggtactta ccatcgcatc tgatgacctg        60
     tggatcgaga gttcagcgat ccaacaatta cacaccacgg caaatttacc cgacatgcaa       120
     cgcgtagtag ggatgccaga tttacacccc ggacgcggct atccgattgg cgcagcgttc       180
     ttctccgtag gccgttttta cccggcactg gtcggcaatg atatcggctg cggtatggcg       240
     ctatggcaaa cagatatttt cgcgcgcaaa tacaacgccg ataagtttga aaagcgatta       300
     tcagatctgg atgacgttgc tgaagaaagc tggctggagg aaaacctgcc gtcagcattt       360
     gcacagcatc cgtggcgcag ctcgcttggc tccatcggtg gcggtaacca cttcgcagaa       420
     ctgcaacaga ttgatcaaat tatcgacgcg gaactgtttg cactggctgg tctggatgcg       480
     cagcatctgc aactgctggt tcatagcggc tcgagggggt tggggcagtc tattttacag       540
     cggcatattg cctcgttttc gcatcatggt ttgccggaag gcagtgacga cgcgctaagt       600
     tatattgcgg aacatgatga tgcgctggcg tttgcgcgta ttaatcgcca gctgatcgct       660
     ttgcgcataa tgcaacaagt taaggccaac ggaaattcgg ttctggatgt ggcgcataac       720
     tttgttagcg catgtcgaat cggcgatcaa cagggctggt tacaccgtaa aggggctacg       780
     ccggatgaca acggtctggt gattattccc ggttcacgcg gtgattactc ctggctggtt       840
     aagcctgttg cgaacgaaaa aacgctccac tcgctggcgc atggggcagg gcgtaaatgg       900
     gggcgcaccg agtgtaaagg gcgtctggca gcgaaataca cggcgacgca actctcacgt       960
     actgaacttg gcagtcgggt aatttgtcgc gataaacaac tcatctttga agaagcgcca      1020
     caagcctata aatcggctga aagtgtggtg caatgtctgg tgctggctgg gttaattatt      1080
     cctgtcgcgc gactgcgtcc ggtgctgacg ctcaaaaaca gtggagggaa aaaaggatga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page