(data stored in ACNUC7421 zone)

EMBL: FM180568.PE246

FM180568.PE246       Location/Qualifiers
FT   CDS_pept        complement(275614..277257)
FT                   /transl_table=11
FT                   /gene="ecpD"
FT                   /locus_tag="E2348C_0246"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07794"
FT                   /db_xref="GOA:B7UJD8"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJD8"
FT                   /protein_id="CAS07794.1"
FT                   /translation="MRVNLLIAMIIFALIWPATALRAAVSKTTWADAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRLTGANRWTGLKYNGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWL
FT                   ENSPVSSPLTGLRCINWYAGCNMTTSLILPQTTDASGFYGATVTSGGAKWMHGMLSDAF
FT                   YQYLQQMPVGSSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVN
FT                   LGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREG
FT                   YVASGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT
FT                   LSFITRNGATKTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
     atgagagtta acctactgat agcgatgata atctttgcgc taatctggcc tgcaaccgcg        60
     ctcagagcgg ctgtgagcaa aacaacctgg gcggatgcac cggcacgcga gtttgtgttt       120
     gtcgaaaaca actcagacga caactttttc gtcactcctg gcggggcgct ggatccgcgc       180
     ctgaccggtg ccaaccgctg gaccggttta aaatacaatg gttcaggaac catctatcag       240
     caaagcctcg gctacattga taacggttac aacaccggcc tttataccaa ctggaagttt       300
     gatatgtggc tggaaaattc accagtttca tctcctttaa ctggcttgcg ctgcatcaac       360
     tggtacgctg ggtgtaatat gaccaccagt cttatcctgc cgcaaaccac cgacgccagt       420
     ggattttatg gcgcgacggt gaccagcggc ggcgcgaagt ggatgcacgg catgttgtca       480
     gacgcatttt accagtatct gcaacaaatg cccgtcggca gcagctttac aatgaccatc       540
     aatgcctgcc agacctctgt gaactatgat gccagcagcg gcgcacgctg taaggatcag       600
     gcctccggca actggtatgt tcgcaacgtc acccatacga aagcagcaaa tctgcggttg       660
     ataaataccc actcgctggc ggaagtattt atcaacagcg acggagtacc gactctgggc       720
     gaagggaatg ccgactgccg gacgcaaacc atcggcagcc gttcaggatt aagttgtaag       780
     atggttaact ataccctgca aacgaacgga ctcagcaaca cctcaatcca tatattcccg       840
     gcgatcgcca actcgtcgtt agcctcggcc gtcggggcgt acgatatgca gttcagtctg       900
     aatggcagtt catggaaacc tgtgagcaat actgcctatt actacacctt caacgagatg       960
     aagagcgcag actcgatcta tgttttcttc tcgagcaact tctttaaaca gatggtgaac      1020
     ctcgggatca gcgatatcaa caccaaagat ctattcaact ttcgctttca gaacaccaca      1080
     tcaccggagt ctggctggta tgaattttct acctccaaca cgctgattat caaaccccgt      1140
     gatttcagca tcagtattat ctccgatgaa tatactcaga caccgtcgcg ggagggatat      1200
     gtcgccagcg gcgagtcggc actcgatttc ggctatatcg taaccaccag cggtaaaaca      1260
     gctgccgacg aagtgctgat caaggtgacc ggacccgcgc aggtgattgg cgggcgctcc      1320
     tattgtgtct tcagctccga tgacggtaag gcgaaagtac cgttcccggc gacgctttcc      1380
     tttattaccc gcaacggagc tacaaaaacc tacgatgccg ggtgcgatga tagctggcgg      1440
     gatatgaccg atgcgctgtg gttgaccaca ccgtggactg atatctctgg cgaagtgggg      1500
     cagatggata agaccacagt caaattttcg attccaatgg ataacgccat ttctctgcgt      1560
     acggtagatg ataacggctg gtttggcgaa gtcagcgctt caggagagat tcatgttcag      1620
     gcgacgtggc gtaacattaa ctaa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page