(data stored in ACNUC7421 zone)

EMBL: FM180568.PE251

FM180568.PE251       Location/Qualifiers
FT   CDS_pept        282198..282488
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0251"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07799"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJE3"
FT                   /protein_id="CAS07799.1"
FT                   /translation="MICQSVRCFNGLTCRTKWLWVFIPISDEKLNRCKYVICPVSPLRA
FT                   KLSEVKRRLPVVTGTMASLPGHCIQSSVRVTLTGTRTSAMGLPMDLAVPVA"
     atgatttgcc aatcagtaag gtgttttaat ggattaacat gccgcacaaa atggttatgg        60
     gtgttcatcc caataagtga tgaaaaatta aacaggtgta agtacgtcat ctgtccggta       120
     agccccctaa gagccaaatt aagtgaagtt aaacgaagac tgccagttgt cacaggaacg       180
     atggcctctt tgccagggca ctgcattcag tcatctgtgc gtgttactct aactggcact       240
     cgaacgtcgg cgatggggtt accgatggat ctggccgttc ctgtggcgta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page