(data stored in ACNUC7421 zone)

EMBL: FM180568.PE424

FM180568.PE424       Location/Qualifiers
FT   CDS_pept        complement(475527..475949)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0424"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07972"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKG8"
FT                   /protein_id="CAS07972.1"
FT                   /translation="MMNSSIKSFSLLAVILLAGCSSPTSRIADCQAQGVSHDTCYLAEQ
FT                   QRQTAILSASEAQAFKNAEAAQHAQAAKKAIYKGFGMTFRMSSKNFAYLNDSLCVIDED
FT                   NKDATVYQSGLYNVIVYHHTGKVALMKEGQFVGYLK"
     atgatgaata gctccattaa atcgttttcc ctgctggcgg ttatattact ggctggctgt        60
     agttcaccca cttcccgcat cgcagattgc caggcgcagg gcgtcagcca tgacacctgt       120
     tacctcgcag aacaacagcg tcagacggct attttaagtg catccgaggc gcaggcattt       180
     aaaaatgcag aagccgcaca acatgcccag gcggcaaaga aagccattta taaaggattt       240
     ggcatgacct ttagaatgag cagtaagaac tttgcttatc tcaatgattc attatgtgta       300
     attgatgaag acaataaaga tgctactgtt tatcagtcgg gtctgtataa tgtcattgtt       360
     tatcatcaca caggaaaagt cgccttaatg aaagaaggcc agtttgtggg ttatttaaaa       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page