(data stored in ACNUC7421 zone)

EMBL: FM180568.PE425

FM180568.PE425       Location/Qualifiers
FT   CDS_pept        complement(476003..477019)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0425"
FT                   /product="predicted autotransporter adhesin, STEC
FT                   autoagglutinating adhesin (Saa)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07973"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKG9"
FT                   /protein_id="CAS07973.1"
FT                   /translation="MKTVNVALLALIISATSSPFVLAGDTIEAAATELSAINSGMSQSE
FT                   IEQKITRFLERTDNSPAAYTYLTEHHYIPSETPDTTQTPPVQTDPDAGQKTVAATGDVQ
FT                   TTARYQSMINARQSTVTDAQQTQITEQQAQIVATQKTLAATGDTQNTAHYQEMINARLA
FT                   AQNEANQRTTTEQGQKMNALTTDVAAQQQKERAQYDKQMQSLAQKSVQAHEQIESLRQD
FT                   SAQTQQQLTNTQKRVADNSQQINTLNNHFSSLKNEVEDNRKEANAGTASAIAIASQPQV
FT                   KTGDLMMVSAGAGTFNGESAVSVGTSFNAGTHTVLKAGISADTQSDFGAGVGVGYSF"
     atgaaaactg taaacgtagc tttactggca ctcataattt cagcaacatc cagccctttt        60
     gttttagctg gtgataccat tgaagcggcg gcaacagagc tttcagccat taactcgggc       120
     atgtcgcaat cggagattga gcagaagatt acccgctttt tagaacgcac cgacaacagc       180
     cccgctgcat atacctattt gactgaacat cactacatcc cttctgaaac acctgatacc       240
     actcagactc cccctgtcca gacagatcct gacgcaggac aaaaaaccgt tgccgctaca       300
     ggtgatgtac agacaaccgc ccgttatcag agcatgatca acgcccgaca gtctacggta       360
     actgatgccc agcaaacgca aattacagag caacaggcgc agatcgtagc cacacaaaaa       420
     acgctcgccg cgactggaga tacgcaaaat accgcgcatt atcaggagat gattaatgcc       480
     aggctggcgg ctcaaaatga ggctaatcag cgcactacca cggaacaagg gcagaaaatg       540
     aatgcactga caaccgatgt ggcagcacaa cagcaaaaag aaagggctca atacgataaa       600
     caaatgcaaa gtctggcgca gaagtctgtc caggcacatg agcaaattga aagtctgaga       660
     caagattccg cacaaacgca gcaacagtta accaacaccc aaaaacgggt tgcagataac       720
     agccagcaaa ttaacacgct caataaccat ttcagttcgc taaaaaacga agttgaggac       780
     aatcgtaaag aagccaatgc gggaactgca tctgccatcg ctatcgcctc acaaccacag       840
     gtgaaaaccg gtgacttgat gatggtctca gcgggagcgg gaacctttaa cggtgaatct       900
     gcggtgtctg tcggaacatc ttttaatgcc ggaacgcata cggtacttaa agcaggtatt       960
     tctgcggata cacaatctga tttcggtgcg ggtgtcggcg tgggatattc gttctaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page