(data stored in ACNUC7421 zone)

EMBL: FM180568.PE426

FM180568.PE426       Location/Qualifiers
FT   CDS_pept        477387..477749
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0426"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07974"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH0"
FT                   /protein_id="CAS07974.1"
FT                   /translation="MNEFEKIFNEMNLDRALLPILFRSNRSTVWKYLSGDSTAPASAMS
FT                   LIMLLQLIQKRNPDLLAEWLTLSDFTIPPEVYLDQPDYWKGWVYTQHKVNKNVLEYLKK
FT                   HYPDEDQKSMGKGREE"
     atgaatgaat ttgagaagat ttttaatgaa atgaatctgg accgggcatt gctaccgatc        60
     ctttttcgtt cgaaccggtc aacagtgtgg aagtatttaa gcggcgatag tacggctcct       120
     gcctcagcta tgtcactgat tatgctgttg cagttaatcc agaaacgaaa ccccgatcta       180
     ttagccgaat ggttaacgct ttctgatttc accattccgc cagaagttta cctggaccag       240
     cctgattact ggaaagggtg ggtgtatacc caacacaagg tcaataaaaa cgtcctggaa       300
     tatctaaaaa aacattatcc ggatgaagac caaaaaagta tgggtaaagg ccgggaagag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page