(data stored in ACNUC7421 zone)

EMBL: FM180568.PE465

FM180568.PE465       Location/Qualifiers
FT   CDS_pept        complement(517038..517694)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0465"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08013"
FT                   /db_xref="GOA:B7UKK7"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR016584"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKK7"
FT                   /protein_id="CAS08013.1"
FT                   /translation="MKKNTDDGAKIYTPLTLKLYDWWVLGVSNRLAWGCPTKEHLLPHF
FT                   LEHLGNNHLDIGVGTGFYLTHVPESSLISLMDLNEASLNAASTRAGESKIKHKISHDVF
FT                   DPYPAALHGQFDSISMFYLLHCLPGNISTKSCVIRNAAQALTDDGTLYGATILGDGVVH
FT                   NSFGQKLMRIYNQKGIFSNTKDSEEGLTHILSEHFENVKTKVKGTVVMFSASGKK"
     atgaaaaaaa acacagatga tggggctaaa atttacacac cacttaccct aaagctttat        60
     gactggtggg ttttgggagt atcaaatcgg cttgcatggg gatgtcctac aaaggaacac       120
     cttcttccac actttctgga acatttaggt aacaaccatc tggatattgg tgttggaact       180
     gggttttacc ttactcacgt acctgagagt agtctgatat ctttaatgga tttgaacgaa       240
     gctagcctga acgcggcatc gacaagggct ggggaatcaa aaattaaaca taaaattagc       300
     catgatgttt ttgatcctta tcccgcggcg ttacatggtc aatttgattc catttccatg       360
     ttttaccttc ttcactgcct gcctggaaat atatctacaa aaagctgtgt aatacgcaat       420
     gcggcgcagg ccttaactga cgatggaact ctatacggag ccacaattct tggtgacggc       480
     gttgtgcaca atagcttcgg tcaaaaactg atgcgcattt acaatcagaa aggcatcttt       540
     tcaaacacaa aagattccga agaaggctta acacatatac tctcagagca tttcgagaat       600
     gttaaaacca aggttaaagg tactgtagta atgttttccg cttcagggaa aaaatag          657
//

If you have problems or comments...

PBIL Back to PBIL home page